KEGG   Trypanosoma cruzi: 506773.140Help
Entry
506773.140        CDS       T01012                                 

Definition
(RefSeq) DNA ligase
Organism
tcr  Trypanosoma cruzi
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_OB_2
Motif
Other DBs
NCBI-GeneID: 3548516
NCBI-ProteinID: XP_816609
GeneDB: Tc00.1047053506773.140
UniProt: Q4DQE8
LinkDB All DBs
AA seq 583 aa AA seqDB search
MMKLHRILRSLPFVPMALSTFDTIERSAASSTATDSTSHSFVSDGPPYFISPKHDGVRIL
SYVSEHAESLKSTCFSRFGRPVHGMFWIEEELRLLRWLCGDPRLVLDGELYVHKEPHARS
TGDDGARTGFFSVSALVHRLRGPKSACSSEEEVLSYVASLPRLCVFDIVSFQPSDKTNLS
EESSGRGLSRIEKERVSLLREVMKANGVRDLEMLRVIPNYSVFSQRLKAMHFLMCVLHRA
RASSILFPGRAVSVTTSKKHEMKRRNGNSSDMAVGVTNVGGEYLQLVKYSLLHSLDDAKK
VYLKKYLSCGYEGAVIRSASNVYELKEKERGVLLGLLDPLISVGERPFVNKQAACWPKRS
LLVAEAPPLLRTYAKNGLLASMGSGEYDWTDFVADENEAEEANHQAVVGAAVRRAKQNAR
RSTTAVKLLPFCDREYAILKPLLKIPSANPRARKLVSVPLKLLHGGRDAISVPRTAFGKA
ASKKNEKSKVAVFYGLQCLSETGRVFNVSLPKMDVAKQRALLDHLLEVTGGSRKMGGKRN
TGGVGCRSLTGLYATVKYSSLTEYGIPRFGQVKAIRGGKGWFL
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcttcatcgcattctgcgtagtctaccttttgtaccaatggctttatccacc
tttgataccatagaacgctctgcagcttcttctactgccacagattcaacatcgcattca
tttgtgtcagatggtccaccatacttcatctcaccgaagcatgacggagtgcgcatcctg
tcgtacgtgagtgaacatgccgaatccctcaaatcaacgtgtttttctcgctttgggcga
cctgttcatggcatgttttggattgaagaagaactccgtctcttgcgatggctctgcgga
gacccacggctggtcttggatggagagctatacgttcataaagagcctcatgcacgatca
acgggtgacgatggggctagaaccgggtttttctctgtttcagctctggtgcatcgtttg
cgcgggcctaaatcggcctgttcctctgaggaggaggtgctcagttatgttgcgtcactc
ccccgtttgtgtgtgtttgacattgtttcctttcagccatcggacaagacaaatttgtct
gaggagagcagtgggcgaggcctttcgcggattgagaaggagcgcgtgtcgcttctccga
gaggtgatgaaggccaatggcgttcgtgatttagaaatgctgcgtgtcattccaaattat
tcagtcttttcacagcgattgaaggcgatgcattttctaatgtgcgtcttgcatcgcgcc
cgcgcctcttctattttgttccctggcagggctgtgagtgtcaccacctccaagaaacat
gagatgaaaagacgaaacggcaactcttccgatatggcggtgggtgtgacaaacgtcggt
ggggagtatttgcagcttgtgaagtactcgctgcttcactcccttgacgatgcaaaaaag
gtgtatctcaagaaatatctctcatgcgggtatgaaggtgccgtcattcgcagtgcgtca
aatgtgtatgagctgaaggagaaggaaagaggtgtcttactggggctcttggacccactc
atttccgtgggggaacgcccgtttgtgaacaaacaggctgcctgctggccaaagcggtcg
cttctggtggcggaggccccgccactccttcgcacatatgccaagaacggattgctcgct
tccatgggttctggtgaatacgattggacggattttgtagcggatgagaatgaagcagag
gaggcgaatcaccaggctgtcgtgggggcagcagtaaggcgggcaaagcagaatgctcgc
cgtagcaccacagctgtcaaattgcttccgttttgtgacagggagtatgcaattctaaag
ccactgctgaagataccgtcagccaacccacgcgctcgaaaacttgttagcgttcctctg
aaattgcttcacggaggtcgtgatgccatctcagtccctcggaccgcttttgggaaggcc
gcgtccaagaagaatgagaagagcaaagtggcagttttttacggtctgcagtgtctcagc
gaaacggggcgtgtgtttaacgtttcacttcccaagatggatgtcgcgaagcagcgagcc
ttgctggatcacctcttggaagtgacagggggctccaggaagatgggtgggaaaagaaac
actgggggagttggttgccgttcactgactggtttgtacgccacggttaagtattcttca
ctcacggagtacggcattccgcgttttggtcaagtgaaggccatacgcggaggcaaggga
tggtttttgtga

DBGET integrated database retrieval system