KEGG   Torulaspora delbrueckii: TDEL_0B00960Help
Entry
TDEL_0B00960      CDS       T02236                                 

Gene name
TDEL0B00960
Definition
(RefSeq) hypothetical protein
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
tdl  Torulaspora delbrueckii
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    TDEL_0B00960 (TDEL0B00960)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TDEL_0B00960 (TDEL0B00960)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TDEL_0B00960 (TDEL0B00960)
   00430 Taurine and hypotaurine metabolism
    TDEL_0B00960 (TDEL0B00960)
Enzymes [BR:tdl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     TDEL_0B00960 (TDEL0B00960)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:complement(177083..178822)
Genome map
AA seq 579 aa AA seqDB search
MLHKHSDRQKRPRTLVQHHHMDSYKGLEEANLLPQQVQGLHLGTATKAEEHEGNHILSNR
YKIPQRGIGEQTAYDLIHNELTLDGNPHLNLASFVNTDASDIARRLISENMLKNLADNDE
YPQLIEITQRCISMLAQLWKCDNEKDDPIGCATTGSSEAIMLGGLAMKKRWEHRMQDAGK
SIAKPNIVMSSACQVALEKFARYFEVECRLIPVSTKSHSCLDPKMLWDYVDENTIGAFVI
LGTTYTGTLENVEQVSEVLTEIENANPKWSNKDIPIHVDGASGGFVVPFAFEEAQLAEYK
MSRWGFNHPRVMSINTSGHKFGLTTPGLGWVLWKDESLLASELKFKLKYLGGVEETFGLN
FSRPGFQVIHQYYNLVTLGHQGFHSHFNKSLFVARAFCHELLASPRMPNMFEVVSCIHER
IADDKLPESVNDYWENPAHFKPGVPLAAFKLSREFHEKYPEIPQSMLSSMLRNRGWIIPN
YPLPKSTDDSDQHEVLRVVFRTEMKLDLAQLLLLDIERAVTKLLDSYKAVTESLANKGAD
ENREFVYKMLLTLASPSDDSAPPEHKHRKSFSKNYRGTC
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgctacataaacactcggacagacaaaagagaccaagaactttggtgcaacatcaccat
atggactcatataagggtcttgaagaggccaatttgctaccccagcaagtgcaaggcttg
cacttgggaacagcaaccaaggctgaagagcacgagggcaaccatattttgtcgaatagg
tataagattccccagagaggcattggggagcaaacggcttatgatctaattcataatgaa
ctgactttagatgggaatcctcacttaaatctagccagttttgtcaacacggatgccagt
gatattgccaggagattgatcagcgagaatatgttgaagaatttggctgataacgacgag
tatcctcaattgattgagataactcagagatgtatctctatgcttgctcaattgtggaaa
tgcgacaacgagaaggacgatcctattggatgtgccactacgggttctagtgaggccatc
atgcttggtgggttagcaatgaagaaaagatgggagcacaggatgcaagatgctggcaaa
tccatcgccaaacccaatatcgtgatgtcttctgcttgccaggtcgccctggagaagttt
gcaaggtactttgaagtcgaatgcaggttaattccagtatccactaagagtcatagttgc
ctggaccccaagatgttgtgggactacgtagacgagaatacgattggtgcgtttgttatt
cttgggactacgtatacaggaacgttggaaaacgttgagcaagtttcagaagtgttgacc
gagatagaaaacgcgaaccctaagtggtcgaacaaggatattccaattcatgttgatggt
gcttcaggtgggttcgtcgtaccctttgcgtttgaagaagcgcaattggcagagtacaag
atgagcagatgggggtttaaccaccccagagtaatgagtattaacaccagtggtcacaaa
tttggtctgacaacccctgggcttggttgggtactgtggaaggacgaatcactactagca
agcgagttaaaattcaaactaaagtatttgggtggtgtggaagagactttcggattaaac
ttctcgagaccaggcttccaagtgattcatcagtactacaacctagtgacattgggccac
caggggttccacagccatttcaataagtcactgtttgtagcacgggctttctgtcacgag
ctattagcttcgccacggatgcccaacatgtttgaagtcgtcagctgtatccacgagagg
atagccgatgacaagttaccagagtcggtcaacgattactgggagaacccagcacacttc
aagccaggtgtaccactggctgcattcaagttatcgcgcgagttccacgaaaagtatcct
gagatcccacaatcgatgctatcatctatgctacgtaaccgtgggtggatcattccaaac
tatcctctaccaaagtctacagacgactcagaccagcacgaagtgctgcgcgtagtgttc
cggacggagatgaaattagatttggcacagctattgctactggatatcgagcgcgctgtg
acgaagctattggatagctacaaggcagtgacagagtcacttgccaacaaaggcgcggat
gagaaccgcgaatttgtgtacaagatgttgctaacgttagcctcaccttcagacgactct
gctcctcctgagcacaagcacaggaaaagtttctccaagaactacagaggtacgtgttag

DBGET integrated database retrieval system