KEGG   Torulaspora delbrueckii: TDEL_0C03400Help
Entry
TDEL_0C03400      CDS       T02236                                 

Gene name
TDEL0C03400
Definition
(RefSeq) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl04146  Peroxisome
tdl04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    TDEL_0C03400 (TDEL0C03400)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    TDEL_0C03400 (TDEL0C03400)
Enzymes [BR:tdl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     TDEL_0C03400 (TDEL0C03400)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 11500564
NCBI-ProteinID: XP_003680440
UniProt: G8ZRT7
LinkDB All DBs
Position
3:complement(600910..601374)
Genome map
AA seq 154 aa AA seqDB search
MVKAVALLKGDAGVSGTVYFEQKSESEPTTVSWEISGNDANAERGFHIHEFGDNTNGCTS
AGPHFNPTGKTHGAREAEVRHVGDLGNLKTDGKGVAKGSLQDSLIKLTGPTSILGRTVVI
HAGQDDLGKGGVEESLKTGNAGGRNACGVIGITK
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagctgtagcattgttgaagggtgacgcaggtgtgtctggtactgtttacttc
gagcagaagtccgaaagtgaacctactaccgtttcatgggaaatttccggtaatgatgcc
aacgctgagcgtgggttccacattcacgagtttggtgacaacactaacggttgtacctcc
gctggtccacatttcaaccctactggtaagacacacggtgctcgtgaggccgaagttaga
cacgttggtgacttgggtaacctcaagaccgatggcaagggtgtcgctaagggttctcta
caggactcactgatcaaattgaccggtccaacttctatcttgggtagaaccgttgttatc
catgccggtcaggatgacttgggtaaaggtggtgtcgaggagtctttgaagaccggtaat
gccggtggaagaaacgcctgtggtgtcattggtattaccaaatga

DBGET integrated database retrieval system