KEGG   Torulaspora delbrueckii: TDEL_0C06700Help
Entry
TDEL_0C06700      CDS       T02236                                 

Gene name
TDEL0C06700
Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
tdl  Torulaspora delbrueckii
Pathway
tdl00010  Glycolysis / Gluconeogenesis
tdl00051  Fructose and mannose metabolism
tdl00052  Galactose metabolism
tdl00500  Starch and sucrose metabolism
tdl00520  Amino sugar and nucleotide sugar metabolism
tdl01100  Metabolic pathways
tdl01110  Biosynthesis of secondary metabolites
tdl01130  Biosynthesis of antibiotics
tdl01200  Carbon metabolism
Module
tdl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tdl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TDEL_0C06700 (TDEL0C06700)
   00051 Fructose and mannose metabolism
    TDEL_0C06700 (TDEL0C06700)
   00052 Galactose metabolism
    TDEL_0C06700 (TDEL0C06700)
   00500 Starch and sucrose metabolism
    TDEL_0C06700 (TDEL0C06700)
   00520 Amino sugar and nucleotide sugar metabolism
    TDEL_0C06700 (TDEL0C06700)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    TDEL_0C06700 (TDEL0C06700)
Enzymes [BR:tdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     TDEL_0C06700 (TDEL0C06700)
Membrane trafficking [BR:tdl04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    TDEL_0C06700 (TDEL0C06700)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 11501976
NCBI-ProteinID: XP_003680770
UniProt: G8ZQS2
LinkDB All DBs
Position
3:complement(1223946..1225454)
Genome map
AA seq 502 aa AA seqDB search
MSFDDLHKATAKALTQKVDDICKEFAIDADKLSELTAYFVESMEKGLQPLDAGESEETAK
GLPMIPSFVTGKPNGTEKGVLLAADLGGTNFRVCSVDLSGDHTFSLQQMKSKIPEELLED
DSVTSQELFGYLARRTVAFMKKYHPELLEEHAKDTAKPLKMGFTFSYPIDQKSLGSGTLI
RWTKGFKIKDTIGKDVVQLYQEQLNASNLGMINVVALTNDTVGTFLSHCYSSGTADSLSS
GEISEPVIGCIFGTGTNGCYMEEIKNIVKLPEETRAKLLQEGKTHMVINTEWGSFDNELK
HLPTSKYDIEIDQKLSANPGFHLFEKRVSGMFLGELLRNMLVDLHAKGLILNQYRSYAQL
PHRLRVPFELSSEVLSHIEIDDSTGLRETELSLLQSLRLPTTPTERVEIQKLVRAISRRS
AYLAAVPIAAILTKTGALNKRYHGEVEVGCDGSVVEYYPGFRSMLRHALSLSPIGSDGER
KVHLRIAKDGSGVGAALCALVA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcgatgatttacacaaggcaacggccaaggctttaacccaaaaagtggatgac
atatgtaaagaatttgcaattgatgctgataaattgagtgaattgacagcttactttgta
gaatctatggaaaaaggtttacagccattggatgcgggcgaaagtgaggagactgcgaag
ggtttgccaatgattccgtcttttgtcactggtaagcctaatggtactgagaaaggtgtc
ttactggcagcggatcttggtggtactaatttcagagtttgttccgttgacttgagtggt
gatcacactttttcattgcaacagatgaagtccaagattcctgaagaattgctcgaggat
gatagtgttaccagtcaagagctatttggctatttggctcgtcgtaccgttgcatttatg
aagaaataccatccggaactgctggaagaacatgctaaggatacagctaaacctctgaaa
atgggattcaccttttcttatccaattgaccagaagtctctgggctctggtactttgatc
agatggaccaaaggttttaagatcaaggatactattgggaaggatgttgtgcaattgtat
caggaacaactgaacgcttcaaaccttggtatgattaacgtcgtggcattaaccaacgat
acagtcggtacatttctttcccactgctactcttctgggactgccgattctctatcctct
ggtgagatctcggagcccgtcattggatgtatctttggtacgggtaccaatggttgttat
atggaagagattaagaatatcgttaagttacctgaagaaaccagggcaaagctactacaa
gagggtaagactcatatggtgatcaacaccgagtggggctcctttgataatgaattgaaa
caccttcctacctcgaagtacgatattgagattgaccaaaaactgtctgctaacccaggg
tttcaccttttcgagaagcgtgtctctggtatgttcctcggtgaactgctaagaaacatg
ctagttgatttgcacgcgaaaggtttaattctcaatcaatatcgttcatatgcacaatta
ccccatcgtttgagggtcccattcgagctctcaagtgaagtgctttcacatatcgagatc
gatgattccacaggtctacgtgaaacggaattgtccttgttgcaaagtctaagattacct
actactccaactgaacgtgttgagattcaaaagttggttcgtgctatctctcgtagatct
gcgtatctggctgctgttccaatcgccgcaatcttgactaagacaggcgctttgaacaag
agataccatggtgaagtagaagtaggctgtgacggttcagtggtcgaatactacccaggt
ttcaggtcaatgctgagacatgccctatctttgagtccgatcggctcagatggtgagcgt
aaagttcatctgcgtattgccaaggatggctcaggggtgggggccgccctttgtgcactg
gtcgcttga

DBGET integrated database retrieval system