KEGG   Torulaspora delbrueckii: TDEL_0G04510Help
Entry
TDEL_0G04510      CDS       T02236                                 

Gene name
TDEL0G04510
Definition
(RefSeq) hypothetical protein
  KO
K10777  
DNA ligase 4 [EC:6.5.1.1]
Organism
tdl  Torulaspora delbrueckii
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    TDEL_0G04510 (TDEL0G04510)
Enzymes [BR:tdl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     TDEL_0G04510 (TDEL0G04510)
DNA repair and recombination proteins [BR:tdl03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     TDEL_0G04510 (TDEL0G04510)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
7:819479..822388
Genome map
AA seq 969 aa AA seqDB search
MESAEILTSTHEVSQELQESESTEKAPPNFAPSPDFIWLCEELFVKLEDVQRQGREHLGN
KPLSVRYYEVISHFIRLWRKTVGNNIFPALVLSLPYRDRRIYNIKDYTLVKAICSYLALP
KQSATEKRLLKWKRRATRGVRLSNFCVEEIRKRKSEPSPGRRITIDKLNECLDHLVEERN
AKGGFKGLSDSPTFNFCLQNMSFIELRFFFDIVLKNRVIGGQEHKLLNCWHPDALDYLSV
VSDLETVASRLWDPEHRLRRDDLSINLGYAFVPQLAKKMTISYEKICTKLNNDFLIEEKM
DGERIQVHYMDYGAKIRFLSRRGVDYTQLYGENLQSGTVANYLNFDSNVRDCVLDGEMIT
FDTDRNVVLPFGMVKSSARQALSTEGICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEF
LNRVLKPCPHAVEILPYVRCSEHTAIRKSLEKSISMGSEGIVLKSYKARYEIGARNDYWI
KVKPEYLEQFGENLDLVIIGRTPGKKDSLMCGLAVYEGEEDLNEIEAKRESAIVNLDSEG
DELDDTDGKKIIKYFISFCVIANGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKI
PEEWIDPKNSIMLEVKARSLDNTESSKKKFAAGCTLHGGYCRRIRDDKDWTGCYSFSELW
QERLHKSSTGVGSFNKQYSKKMKSKKRKIDPFSGQAAKKHDVFDSTNIFKGLQFYVLSDY
IDVSRNVRITKSEFDDLILQNSGKLVRNLISKHHSESQFRIISGKYTAECRALIERGYDI
LSPQWILDCIRNRMVVKLEPRHCFNVSSELMTIVNGRVDEYGDSFVNPITEQQLDNLIDT
NMKQTEPNLMREANSELDVVPLFLFSTRAVYIPPQVFNAVDAYGLTSKFKLHGGSIASDI
PSCNLIIMPNENQRLGTQSLVEMRQSVLQAMGRNDSTPSIPYIVTPDWVEKSIEENCQVP
EEDFTPVYA
NT seq 2910 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgctgaaatcttaacgagcacacatgaagtttcgcaagagctccaagagtct
gagtcaactgagaaggcgccaccaaattttgcaccatctcctgactttatttggctatgt
gaagaactctttgtgaagttggaagacgttcaaagacaaggtcgcgagcatttgggaaat
aaaccactatctgttaggtactacgaagttatatcgcattttatcaggttgtggcggaaa
acggtagggaacaacatctttccagcactcgtactatcacttccctacagagacagacga
atttataacatcaaagactacacgctggtcaaggcaatatgttcttacttggcgttacct
aaacaatctgccaccgagaaaaggctgctcaaatggaaaagaagagctacaagaggggta
agactatcaaatttctgcgttgaagagatcagaaagaggaaaagtgagccatcgccaggg
aggcgaataacaattgacaagctaaacgaatgccttgatcatcttgtcgaagagcgaaat
gccaagggaggatttaaaggtttatcagattcaccaacattcaacttttgcctgcaaaac
atgtcttttattgagctcaggtttttctttgatattgtattaaaaaatagagtaatcggt
ggacaggaacacaagcttttgaactgttggcatccagatgctctagattatttaagcgtt
gtctctgatttggagactgtagcttcgagactgtgggatccagaacaccgtctgagacgt
gacgacttgagcatcaatcttgggtatgcttttgtcccgcagcttgctaagaagatgact
atttcttatgaaaaaatctgtaccaagttgaataatgacttcttgattgaagaaaaaatg
gatggcgagcggattcaagtacattatatggattatggagccaaaatcagattcttaagt
aggcgtggggtcgactatactcagctctatggagagaatttacaaagtgggacagtggca
aattacttgaattttgatagtaacgtgcgggactgcgtacttgatggcgagatgatcact
tttgatactgatagaaatgttgtgctaccttttgggatggtgaagagcagcgctcggcaa
gcccttagcactgaaggaatttgttctcaaggtcatcgtcctatgctaatggtccttgat
ctggtttatttaaatggcgtctccctcatcaaacttcctttgtaccagagaaaggaattt
ctaaatagagtgctgaaaccatgtccccatgcggtagaaatcttgccatatgttcggtgt
tctgaacatactgcgataagaaaatctttagaaaagtcaatttcgatgggatctgaaggt
atagtgctgaaatcctacaaggcgcggtatgaaattggagcaagaaatgactattggatt
aaggtcaaaccagagtacctggaacaatttggagaaaatttagacttggttattatcggg
agaactccagggaaaaaggactctctgatgtgcgggcttgccgtatatgaaggtgaagaa
gatctgaatgaaattgaagcaaaaagagagtccgcaattgtaaatttagattctgaaggg
gatgaactggatgacacggacggcaagaagattatcaaatactttatctcattctgcgta
attgccaacggaatttctcagcaagagttcaaagaaatcgatagaaaaacgcgtggtgct
tgggtaaaatcggaccagcggttaccttcagctgatcttctgagattcggatccaagatc
ccagaagaatggatcgacccgaaaaattcgattatgcttgaggtgaaggcaaggtcattg
gacaatacagagtccagtaagaaaaagtttgcagcgggttgcacacttcatggtggatac
tgcagaagaatcagagacgacaaggattggactggttgctacagtttttctgagctatgg
caagagaggcttcataagtcatcaactggggtcggctcatttaacaaacaatactccaaa
aaaatgaaatcaaagaaacggaaaatagatcctttttcgggccaagccgcgaagaagcat
gatgtctttgactccaccaacatcttcaagggcttacagttttacgttctgtcagattac
atcgatgttagtcgaaatgttcgcataacaaaatctgaatttgatgacctgatattacag
aacagtggcaagctggtacgaaatttgatctccaagcaccatagcgaaagccagtttcgt
atcataagcggcaagtataccgcggaatgcagggcactcatcgaaagaggctacgatatt
cttagcccgcagtggattttggactgtattcgcaatcgaatggttgtaaaactggaacca
cggcattgcttcaatgtttccagtgaattgatgactatcgttaacggaagagtagatgaa
tacggcgatagcttcgtgaacccgattacagagcagcagctagacaatttgattgatacg
aacatgaagcaaacagaaccgaacttgatgagggaagccaactcggaattggatgtagta
ccattattcctattctccacgagggctgtatatattccgccacaggttttcaacgcagta
gatgcgtatggcttgacttcaaagtttaagctacatggtggctcgatcgcaagcgacata
ccaagttgcaacctcattataatgcccaacgaaaatcaacgtctaggcacccagtcactg
gtagagatgaggcagtcagtgttgcaagccatgggtcgtaatgatagtacgcccagtata
ccatacattgtaacacctgattgggtggaaaagtcaattgaagaaaactgtcaagttcca
gaggaggactttacgcctgtgtatgcttga

DBGET integrated database retrieval system