KEGG   Candidatus Tenderia electrophaga: Tel_03295Help
Entry
Tel_03295         CDS       T04171                                 

Gene name
rbcL
Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
tee  Candidatus Tenderia electrophaga
Pathway
tee00630  Glyoxylate and dicarboxylate metabolism
tee01100  Metabolic pathways
tee01120  Microbial metabolism in diverse environments
tee01200  Carbon metabolism
Module
tee_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:tee00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Tel_03295 (rbcL)
Enzymes [BR:tee01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Tel_03295 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ALP52248
UniProt: A0A0S2TAS5
LinkDB All DBs
Position
716482..717894
Genome map
AA seq 470 aa AA seqDB search
MAKKYDAGVKEYRDVYWTPDYVPLDTDLLACFKVTPQEGVPNDEAAAAVAAESSTGTWST
VWSELLTDMEFYKGRAYRIEDVPGDKDAFYAFIAYPIDLFEEGSIVNVLTSLVGNVFGFK
AVKHLRLEDIRFPIAFVKTCLGPPSGIQVERDKLNKYGRPLLGATIKPKLGLSAKNYGRA
VYECLRGGLDLTKDDENVNSQPFMRWQNRFEFVAEAVQKAQQETGETKGHYLNVTANTPE
DMYERAEFAKELGQPVIMHDFLTGGFTANSGLAKWCRKSGLLLHIHRAMHAVIDRHPKHG
IHFRVLAKCLRLSGGDHLHTGTVVGKLEGDRASTMGYVDQLRESFVPEDRSRGIFFDQDW
GSMPGVFAVASGGIHVWHMPALVTIFGDDSILQFGGGTQGHPWGNAAGAAANRVALEACV
KARNQGRDLERESREILEGAAQHSPELAMAMETWKEIKFEFETVDKLDIG
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaatatgatgcgggcgttaaagagtaccgcgatgtgtactggacaccggac
tatgtccccctggataccgacttgttggcctgttttaaggtcaccccgcaggaaggtgtg
cccaatgacgaggccgccgcagccgttgccgccgaatcatccaccggcacctggagtacc
gtatggtcggaattgctgaccgatatggagttctataaaggtcgcgcctatcgtattgaa
gacgtgcccggcgacaaagacgccttttatgcctttattgcctatcccatcgatctgttc
gaagaaggttccatcgtcaacgtgctgacctccctggtcggtaacgtattcggcttcaag
gcggtcaagcatctgcgcctggaagacatccgtttccccatcgccttcgtcaagacctgc
ctgggtccgcccagcggcatccaggtggagcgcgataagcttaacaaatacggccgtccg
ctgctgggcgctaccattaaaccgaagctgggtctgtcggccaagaactacggccgtgcc
gtgtacgagtgtctgcgcggcggtctggacctgaccaaggacgatgagaacgtcaactcc
cagcccttcatgcgctggcaaaaccgtttcgaattcgtcgccgaggcggtacaaaaggcg
cagcaggaaaccggcgagaccaaggggcattacctcaacgtcaccgccaacacgccggaa
gacatgtacgagcgcgctgagttcgccaaggagctgggtcagccggtcatcatgcatgac
ttcctcaccggcggcttcaccgccaacagcggtctggccaaatggtgccgcaagagcggc
ctgttgttgcacatccaccgtgccatgcatgcggtcatcgaccgtcatcccaagcacggc
atccacttccgcgtgctggccaagtgcctgcgactgtccggtggcgaccacctgcacacc
gggaccgtcgtcggcaagctggaaggcgaccgcgcctccaccatgggttacgtggatcag
ctgcgtgagtccttcgtccccgaagaccgcagccgcggcatcttcttcgaccaggactgg
ggctccatgcccggcgtcttcgccgtcgcctccggcggtattcacgtctggcacatgccc
gccctggtcaccatcttcggtgatgactccatcctgcagttcggtgggggtacgcagggc
cacccctggggtaacgccgccggcgccgccgccaaccgtgtcgccctcgaggcctgtgtc
aaggcgcgtaatcaaggccgcgacctggaacgcgaatcgcgcgaaatcctggaaggtgcc
gcccagcacagtcccgagctggccatggccatggagacctggaaagagatcaagttcgaa
ttcgaaaccgtggacaaactcgatatcggctga

DBGET integrated database retrieval system