KEGG   Tepidanaerobacter acetatoxydans Re1: TepRe1_0187Help
Entry
TepRe1_0187       CDS       T01495                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
tep  Tepidanaerobacter acetatoxydans Re1
Brite
Translation factors [BR:tep03012]
 Eukaryotic Type
  Elongation factors
   TepRe1_0187
 Prokaryotic Type
   TepRe1_0187
Mitochondrial biogenesis [BR:tep03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    TepRe1_0187
Exosome [BR:tep04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TepRe1_0187
  Exosomal proteins of breast cancer cells
   TepRe1_0187
  Exosomal proteins of colorectal cancer cells
   TepRe1_0187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
212405..213610
Genome map
AA seq 401 aa AA seqDB search
MAKQKYERKKPHVNIGTIGHVDHGKTTLTAAITRVLSDVGLSNFVDYDNIDKAPEERERG
ITIATSHVEYETENRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPYIVVFLNKADMVDDEELIELVEMEVRELLTEYEFPGDDIPIVTGSALKALE
CGCGKKDCKWCGKIWELMEQVDNYIPTPERDTDKPFLMPIEDVFTITGRGTVVTGRVERG
TVKIGDEVEIVGIAEETRKTVVTGVEMFRKLLDSAEAGDNIGVLLRGINRDQVERGMVLA
KPGSIKPHTKFKGQIYVLKKEEGGRHTPFFNGYRPQFYFRTTDVTGSITLPEGTEMVMPG
DNVVMDVELIAPIAIEPGLRFAIREGGRTVGAGVVTEIIEK
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcagaaatatgaaaggaaaaaaccccatgtaaacatagggacaataggtcac
gtagaccatggcaagacaacccttacagcagcaataaccagagtattatcagatgtggga
ctatcaaactttgtagactacgacaacatcgacaaagcaccggaagaaagagaaagagga
ataaccatagccacatcccacgtagaatacgaaacagaaaaccggcactatgcccacgta
gactgccccggccacgccgactacgtaaaaaacatgataaccggagcagcccagatggac
ggagcaatactagtagtatcagcagcagacggcccaatgccccagacaagagaacacata
ctgcttgcccgtcaagtaggcgtaccctacattgtagtattcctaaacaaagccgacatg
gtagacgacgaagaactaatagaactagtcgaaatggaagtaagagaactacttacagaa
tacgaatttcccggagacgacataccaatagtaaccggctcagccctaaaagccctagaa
tgcggctgcggcaaaaaagactgcaaatggtgcggcaagatatgggaactcatggaacaa
gtagacaactacattcccacaccagaacgtgacacagacaaacccttcctcatgccaata
gaagacgtatttacaataaccggcagaggcaccgtagtcaccggcagagtagaaagaggc
accgtaaaaataggcgacgaagtagaaatagtaggcatagcagaagaaaccagaaaaacc
gtagtaaccggagtagagatgttcaggaaactcctagactccgcagaagctggagacaac
ataggagtattactcagaggcataaacagagaccaagtagaaagaggaatggtacttgcc
aaacccggcagcatcaaaccccacaccaaattcaaaggccagatatacgtcttaaagaaa
gaagaaggcggcagacacacaccattcttcaacggctaccggcctcagttctacttcagg
acaaccgacgtaacaggctccataaccctgcctgaaggcacagagatggtaatgcctggt
gataacgtagtcatggatgtcgaacttatagcacccatagctattgaaccagggcttagg
tttgctattcgtgaaggtggcagaaccgtaggagccggtgtagtaactgagataattgaa
aaataa

DBGET integrated database retrieval system