KEGG   Trichodesmium erythraeum: Tery_0836Help
Entry
Tery_0836         CDS       T00387                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ter  Trichodesmium erythraeum
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ter00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tery_0836
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tery_0836
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Tery_0836
   00680 Methane metabolism
    Tery_0836
Enzymes [BR:ter01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Tery_0836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
CyanoBase: 
Tery_0836
CYORF: 
UniProt: 
LinkDB All DBs
Position
1327223..1330339
Genome map
AA seq 1038 aa AA seqDB search
MSSLLHSKEITLEPGFKNPKMTASDLFLHNRIKIVENLWESVLRQECGQELVDILQKMRS
GHSPEGQASDFLGSEIEQLIEKLELKDAIRAARAFALYFQLINIVEQHYEQKIQQLAYSH
NNSLEKLISKDDIAKDHDTRSLRVESIPVWNDNRIKHEGEGTFHYLFPLLQTLNVPSQLI
QRLINNLDIRLVFTAHPTEIVRRTIRTKQRRIAKILQQLDQVNESLSESHVDEEQVNSLV
SSWKIESLKEQLTEEILLWWRTDELHQFKPSVLDEVETTLHYFNEVLFDATPELHRRFKQ
ALHSSFPYLKPPSYNFCKFGSWVGSDRDGNPFCTPAVTWQTACYQRQIVLEKYLNAIDRL
KELLSLSLHWSDVLPELLDSLDRDHIQMSEVYDQWAIRYRQEPYRLKLSYIKKRLENTRD
RNARLYNGDEVQRQKKEVLSQRQKQVLSQYQETKSIYHSSADFLAELQLIQRNLKETGLS
CSDLENLISQVEIFGFNLARLDIRQESSVHEAAIQEITEYLQILPKSYIEMSEAERTEWL
STELPTRRPLIPTELPFSEKTCEIINTFRMLRELQLEFGEEICQTYIISMSRDVSDLLEV
LLLAQEAGLYDPATGASSIHVVPLFETVEDLRSAPRVMHDLFKLSLYRAGLAGGYDKLSK
EPINELVNEAPYLQEVMLGYSDSNKDSGFLSSNWEIHKAQKALYKVGEEHGIALRIFHGR
GGSVGRGGGPAYKAILAQPGKSISGRIKITEQGEVLASKYSLPHLAMFNLENVTTAVIQA
SLLHTGFDEIETWNQIMEELAVRSRSHYRNLIYEQEDLVEFFYQVTPMPEISQLQISSRP
ARRKNDKKKTISGLRAIPWVFSWTQSRFLLPAWYGVGTALQEFVEKEPEEHLKLLQYFYV
KWPFFTTAISKVEMTLAKVDLQIAHYYVRELSKPEDRERFETLFEEITIEYHLTRNLVLQ
ISGHQRPLDGDPDLQRSVQLRNATIIPLGMLQVALLKRLRQHDTGTPGVINSRYSKSELL
RGALLTLNGIAAGMRNTG
NT seq 3117 nt NT seq  +upstreamnt  +downstreamnt
atgagctcactactacactcaaaagaaataaccctagaaccagggttcaaaaatcctaaa
atgacagcttcagatctgtttctacataatcgaatcaaaatagttgaaaatttgtgggaa
tcagtgctcagacaagagtgtggccaagaattggtagatatactccagaagatgcgctcg
ggtcattctccagaaggacaagcatctgactttctaggttcagaaattgaacaactgatt
gaaaaattagaactaaaagatgcaattcgggcagctcgagcttttgctctatattttcag
ctaattaatattgtcgaacaacattatgaacaaaaaattcaacaactagcttactctcac
aataacagtctagaaaaactaatctctaaagatgatatagctaaagatcatgatacccgt
tcgctgcgggttgagagtataccagtgtggaacgataacagaattaaacatgagggagag
ggtacatttcattatttatttcccctcctacagaccctcaatgtaccatcacaattaatt
caacgactaattaataatttagatatccgtttagtgtttacagcacacccaacggaaatt
gttcgtcgtacaattagaacaaaacaaagacgtatcgccaaaattctccaacagctcgat
caagtaaatgaaagcctttcagaatcacacgtagatgaagaacaagtaaattctttagtg
tcatcttggaaaatagaatccctcaaagaacagttaacagaagaaattcttttatggtgg
cgtacagatgaactacatcaatttaaacctagtgtcttagatgaagtagaaactactctt
cattattttaacgaagtcttatttgatgctactcctgaactacatcgtaggtttaagcaa
gccttacatagttcctttccttatctgaaaccaccaagttacaatttctgtaaatttggt
tcctgggtaggatctgaccgtgatggaaatcctttttgtacaccagcagtgacttggcaa
acagcttgttaccaacgtcagatagtattagaaaaatatcttaatgctattgatcgcctc
aaagaacttttgagtttatctctacattggagtgatgtgttaccagaattgttagattct
ctagaccgtgaccatatacagatgtcagaagtttacgatcaatgggcaattcgctatcgg
caagaaccttatcgtttgaagttgtcttatatcaaaaagcgtttagaaaatactcgcgat
cgcaatgcgcgtttatataatggtgatgaagttcaaagacaaaaaaaagaagttctttct
caacgacaaaaacaagttctctctcaatatcaagaaacaaaaagcatttatcactctagt
gctgattttctagctgaattacaactaattcagcgtaacctcaaagaaactggtttaagc
tgtagtgacttagaaaatctaatctctcaagtagaaatttttggttttaacttagcacga
ctagatattcgtcaagagtcttcagtccatgaagcggcgatccaagagattactgaatat
ttacaaattctgcctaaatcttatatagaaatgtcggaggcagagcggactgaatggtta
tcaacagagttgcctactcgtcgccccttaattcccacagagttacctttttctgagaaa
acctgcgaaataattaatactttccgaatgctgcgagaattacagctagagtttggtgaa
gaaatttgccaaacctatattattagtatgagtagggatgttagcgatctattagaagtg
ttgttgttagctcaagaagcaggactttatgatccggcaactggtgcgagtagcattcac
gtggttcctttgtttgagacagtggaagacttgagaagtgctcccagggtaatgcacgat
ttatttaagttgtccctatatcgtgcagggcttgctggtggatatgataaattatcaaaa
gagccaattaatgaattagttaacgaagctccttatttgcaagaggtgatgttgggttac
tcagatagtaataaagattctgggtttttgagtagtaactgggaaattcataaagctcaa
aaagctttatacaaagtaggggaagagcatggcattgctttgcgtatctttcatggacgc
ggtggttctgtaggacgtggtggcggtccagcttataaagctattttggctcaacctggt
aaaagcattagtgggcggattaaaattactgaacaaggagaggtgctcgcctctaaatat
tctctgcctcacttagcaatgtttaacttggaaaatgttactactgcagtaattcaagct
agtttgctacatacagggtttgatgaaattgaaacttggaatcaaattatggaggagttg
gcagtgcgatcgcgtagccattaccgaaatctgatttatgaacaagaagatctagtagaa
tttttctatcaagttacaccaatgccagaaattagtcaactacaaattagttcccgtcca
gctcggcggaaaaatgataagaagaaaacaatttctggtttaagggcaattccttgggta
tttagttggactcaaagtcgctttctcttacctgcttggtatggtgtgggaactgcttta
caagagtttgtggaaaaagaaccagaagaacacctaaaacttttgcaatacttttatgta
aagtggcctttctttactactgcgatttctaaagtggagatgactttagctaaggtggat
ttgcaaattgctcattattatgtgcgcgaattatccaaaccagaagaccgggaacgcttt
gagacactgtttgaagaaattactattgagtatcacctaacacggaacttagtgctacaa
atttctggtcatcaacgacctttggatggagatccagatttacagcgttctgtacaatta
cgtaatgcaactattattcctctgggtatgttgcaggtagctttgctgaaacgtctgcgt
cagcatgatacaggtacacctggtgtaattaattctcgttatagtaagagtgagttatta
cggggtgctttgttgactcttaatggtatcgctgctggtatgcgaaatacaggttga

DBGET integrated database retrieval system