KEGG   Tetrahymena thermophila: TTHERM_01207690Help
Entry
TTHERM_01207690   CDS       T01020                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase
Organism
tet  Tetrahymena thermophila
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 7834772
NCBI-ProteinID: XP_001021914
TGD: TTHERM_01207690
UniProt: Q23YQ3
LinkDB All DBs
AA seq 932 aa AA seqDB search
MINIKRILGKRTDLLHFINGSSQQSLQQYQKASQGLQFLSGQSKQPKIHNQNFYQFSAMK
RTFDLLNDQKKLKSVTNKEILLANFESRVQLRYQLLNSLFQTLPVDQINETSMLIPILTH
ACQKGLESGLSPEEVIDKFFKEYDQNQIYNTEQKKIDFLFRVVQFVERQVVLVDALEDAN
YSQINDLHGPESLGNLIERIRRHNLDDELLKQLSRFAVRVVLTAHPTQFYPKQVLSIIND
LNEAIQSNDITQIQYLLWQLAKTPFFQREKPTPLDEAQFLIQYLENVFYDAVGTLQDRLR
KVLGSKFDKQKEFHKFYTLGFWPGGDRDGNPFVRVETTKKVAKLLRTSILKCYIRDVRQV
KKRLSFKGIYELLEEIENDFGSNFSYKPSVSLEQLYEKLDFIRQKIITDHNGLFLPIFEN
FQRKVHTFGYHFASIDIRQDSRVLDKTFKALQEKVPYMLPYNFEELPVQQKLDLLLSLKP
LNTVPQLDDEVLNDTLQTFNAMREIQEENGEFGSYRFIISNCRGPLDVAKVYAMSQLTGG
WSGNSKIDVVPLFETIDDLKSADKSMKELFSNGIYQKHLKFRKMRQTIMCGFSDGTKDGG
YLGANWGIYQAKENLSKISRDYGVEAIFFDGRGGPPARGGGNKHLYYASQGPTIENHEIQ
ITIQGQTISSNFGVTDSCLHNLELLMSAGLQNNVLEDPKRVLTQSQRDLLNELSEVSLKS
YLEFKNHPKFMPYLLEKSPLKYYGEANIGSRPAKRSAGGEMKFEDLRAIPFVGAWSQLKQ
NVPGFYGLGTALKKLEAEGRLNEAADLYKDSLFFKALVQNSMMSMCKTYFPLTHYMLKDK
QYSEFWNQIYNEFQETERLLLLITEQKQLLDNEPVIKQSIKLREQIVLPLLTIQQFALQR
INKDHQEDLHKSYQNLIIRSLFGSINATRNAA
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacataaaaagaattctaggaaaaaggactgatttacttcatttcattaatgga
agtagctaacagtctcttcaataatattaaaaggcatcacaaggcttgtagttcctttct
ggatagagcaaatagcctaaaattcataactagaatttttactagttttctgcaatgaag
cgtacattcgatctattgaatgattagaagaagctcaaaagtgtcaccaacaaagaaatt
cttcttgctaactttgagtcaagagtccaactaagatattagcttttaaactctctcttt
tagactcttcccgtagattaaataaacgaaactagtatgttgataccaattttaacccat
gcttgttagaaaggattagaatcaggattaagcccagaagaagttattgataaatttttc
aaagagtatgattaaaactaaatctataacactgagcaaaagaaaatagacttccttttc
cgcgtcgtttagtttgttgaaagataagttgtgctggttgatgctcttgaagatgctaat
tattcataaattaacgatctacatggtcctgaatcattaggtaatttaattgaaagaata
agaagacacaatttggatgatgaactcttgaaatagctttctagatttgctgttagagtt
gtacttactgctcaccctactcagttttatcctaaacaagttctttctatcattaatgat
ttaaatgaagctatttaatctaatgatataacttaaatctaatatctactttggtaacta
gcaaaaactcctttcttctaaagagaaaaacctactccattagacgaggcatagttctta
atttagtatctagaaaatgtattttatgatgcagttggtactctccaagataggctcaga
aaggttttaggttctaaattcgataaacaaaaagagtttcataaattttacactctaggt
ttctggccaggtggagacagagatggaaatccttttgttagagttgaaacaactaaaaag
gtagcaaaattacttagaacttccatcctgaaatgttacatcagagatgtacgctaagta
aaaaagagattgagtttcaaaggaatttatgagctattagaagaaatagaaaacgacttt
ggttctaacttctcatataaaccttcagtaagccttgaataattgtatgaaaaacttgac
tttattagataaaaaattatcactgaccacaatggattatttttacccatctttgagaat
ttctaaagaaaagttcatacattcggataccactttgcttcgattgatattcgttaagat
tctagagttttagataagaccttcaaagcattacaagaaaaagttccttatatgctccca
tataactttgaagaactccctgtctaatagaaattagatttattattgagtcttaagcct
ctcaatacagtaccctaacttgatgatgaagtgttgaatgatactctctaaacttttaat
gccatgagggaaatataagaagaaaatggagaatttggttcctaccgctttatcatttcc
aactgtagaggacctcttgatgttgctaaggtttatgctatgagttagttaactggagga
tggtctggtaattctaaaatcgatgttgtacctctttttgaaactatcgatgatcttaag
tctgcagacaaatctatgaaggaactattttctaacggtatatatcaaaaacacttaaag
tttagaaaaatgaggtaaactatcatgtgtggtttctctgatggtactaaagatggtggc
tatcttggagctaattggggaatttactaagctaaagaaaatctgagtaaaatatctagg
gattatggtgtagaagctatctttttcgatggtagaggtggtccacctgctcgtggtggt
ggtaacaagcacttgtattatgcttctcaaggtcctactatagaaaatcatgaaatccaa
attactatccaaggttaaactatcagctctaacttcggtgttacagatagttgtcttcat
aatttagaactcttaatgtcagcaggtttgtaaaataatgtccttgaagaccctaaaaga
gtattgacacaatcttaacgcgatcttttaaatgaactttccgaggtatctttaaagtcg
taccttgaatttaagaatcatcctaaatttatgccttatctgttagaaaaatctccatta
aaatattatggtgaagctaatattggttccagaccagctaaaagaagtgctggaggagaa
atgaagtttgaagatttaagagctataccatttgtaggagcttggtcacaactcaaacaa
aacgttccagggttttatggcttgggaacagctcttaaaaagcttgaagcagaaggaaga
ctgaacgaagctgcagatttatataaagatagtttattcttcaaagcattagtttaaaac
tctatgatgtcaatgtgtaaaacttacttccccttaactcactacatgttgaaagataaa
taatatagtgaattttggaattaaatttataatgaattctaagaaactgaaagattgtta
cttcttatcactgaacaaaagcaattacttgacaatgaacctgttataaaataaagtatc
aaattaagagaataaattgttctccctctactcactatttagtaatttgcgcttcaaaga
attaataaagatcatcaagaagatcttcataaatcatatcaaaatcttatcatccgttct
ctcttcggtagtataaacgctacaagaaacgctgcttga

DBGET integrated database retrieval system