KEGG   Tessaracoccus sp. T2.5-30: BKM78_12350Help
Entry
BKM78_12350       CDS       T04747                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
tez  Tessaracoccus sp. T2.5-30
Brite
Enzymes [BR:tez01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BKM78_12350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2663377..2663991)
Genome map
AA seq 204 aa AA seqDB search
MTYTLPDLDYDYGALAPHIAPEIMELHHSKHHAAYVKGINDALEQLAAAREKGDLGAVNK
LSKDAAFHLGGHINHSVFWKNMSPDGGGRPDGELASAIDEYFGSFDGFQKHFNAVANGIQ
GSGWSMLVWDTLGQRMNINQLFDQQGNLPAGQIPLLQLDMWEHAFYLQYKNVKGDYVTAW
WNVVNWTDVTERFARAKAASAGLV
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgacctacaccctcccggacctcgactacgactatggggcactggccccccacatcgcc
ccggaaatcatggagctgcaccacagcaagcaccatgccgcctacgtcaagggcatcaac
gacgcgctcgagcagctcgccgccgcccgcgagaagggcgacctcggagcggtcaacaag
ctgagcaaggacgccgcgttccacctcggcggccacatcaaccactcggtgttctggaag
aacatgtcgcccgacggcggcggccgccccgacggcgagctcgcctccgcgatcgacgag
tacttcggcagcttcgacgggttccagaagcacttcaacgccgtcgccaacggcatccag
ggctccggctggtcgatgctcgtgtgggacacgctcggccagcggatgaacatcaaccag
ctgttcgaccagcagggcaacctgccggcggggcagatcccgctgctgcagctcgacatg
tgggagcacgccttctacctgcagtacaagaacgtcaagggtgactacgtcaccgcctgg
tggaacgtcgtcaactggaccgacgtcaccgagcgcttcgcccgggcgaaggccgcctcc
gccggtctcgtctga

DBGET integrated database retrieval system