Tachysurus fulvidraco (yellow catfish): 125146193 Help Entry 125146193         CDS       T08119                                  Symbol mt2 Name (RefSeq) metallothionein-2   KO K14739   metallothionein 1/2 Organism tfd  Tachysurus fulvidraco (yellow catfish) Brite KEGG Orthology (KO) [BR:tfd00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:tfd03019]     125146193 (mt2)    03029 Mitochondrial biogenesis [BR:tfd03029]     125146193 (mt2) Messenger RNA biogenesis [BR:tfd03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      125146193 (mt2) Mitochondrial biogenesis [BR:tfd03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     125146193 (mt2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  125146193 NCBI-ProteinID:  XP_047678353 LinkDB All DBs Position 13:complement(17304168..17304837) Genome browser AA seq 60 aa AA seqDB search MDPCECSKTGSCNCGTSCKCSNCQCTSCKKSCCSCCPSGCSKCASGCVCKGDSCDTKCCQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggatccttgcgagtgctccaagactggatcctgcaactgcggtacatcctgcaaatgc tcaaactgccagtgcacatcatgcaagaaaagctgctgctcttgctgcccttctggctgc agtaagtgcgcctctggatgtgtgtgtaagggcgattcctgcgataccaagtgttgtcag tga

DBGET integrated database retrieval system