Takifugu flavidus (sansaifugu): 130536798 Help Entry 130536798         CDS       T09160                                  Symbol kras Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism tfs  Takifugu flavidus (sansaifugu) Pathway tfs04010   MAPK signaling pathway tfs04012   ErbB signaling pathway tfs04068   FoxO signaling pathway tfs04137   Mitophagy - animal tfs04140   Autophagy - animal tfs04150   mTOR signaling pathway tfs04210   Apoptosis tfs04218   Cellular senescence tfs04370   VEGF signaling pathway tfs04371   Apelin signaling pathway tfs04540   Gap junction tfs04625   C-type lectin receptor signaling pathway tfs04810   Regulation of actin cytoskeleton tfs04910   Insulin signaling pathway tfs04912   GnRH signaling pathway tfs04914   Progesterone-mediated oocyte maturation tfs04916   Melanogenesis Brite KEGG Orthology (KO) [BR:tfs00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     130536798 (kras)    04012 ErbB signaling pathway     130536798 (kras)    04370 VEGF signaling pathway     130536798 (kras)    04371 Apelin signaling pathway     130536798 (kras)    04068 FoxO signaling pathway     130536798 (kras)    04150 mTOR signaling pathway     130536798 (kras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     130536798 (kras)    04137 Mitophagy - animal     130536798 (kras)   09143 Cell growth and death    04210 Apoptosis     130536798 (kras)    04218 Cellular senescence     130536798 (kras)   09144 Cellular community - eukaryotes    04540 Gap junction     130536798 (kras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     130536798 (kras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     130536798 (kras)   09152 Endocrine system    04910 Insulin signaling pathway     130536798 (kras)    04912 GnRH signaling pathway     130536798 (kras)    04914 Progesterone-mediated oocyte maturation     130536798 (kras)    04916 Melanogenesis     130536798 (kras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tfs04131]     130536798 (kras)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:tfs04031]     130536798 (kras) Membrane trafficking [BR:tfs04131]  Endocytosis   Macropinocytosis    Ras GTPases     130536798 (kras) GTP-binding proteins [BR:tfs04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     130536798 (kras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin nSTAND3 Motif Other DBs NCBI-GeneID:  130536798 NCBI-ProteinID:  XP_056908969 LinkDB All DBs Position 13:1811297..1819451 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLNKLSKEEKTPRC VKLRKCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagagtataagctggtagtggtgggagctggaggtgttggcaagagtgcgcttact atccagctcatccagaaccactttgtggatgaatacgaccccaccattgaggactcctac agaaagcaagtagtgattgatggagagacctgtctacttgacatcctggacactgcaggt caggaggagtacagcgccatgagagatcagtacatgaggacgggggagggcttcctctgt gtctttgccatcaacaacaccaagtctttcgaggacattcatcactatagagaacagatt aagcgggtgaaggactctgaggacgtccccatggtactggtggggaacaagtgtgacctc ccgtcccggacagttgacaccaagcaggctcaggacttggcgcgaagctacggcattccc tttattgagacctcagccaaaaccagacagagagtggaagatgccttttacactctggta cgggagatcaggcagtaccggctcaataaactcagcaaggaagaaaagactccacgctgt gtcaagcttagaaagtgtgttgtgatgtga

DBGET integrated database retrieval system