KEGG   Thermobifida fusca: Tfu_0985Help
Entry
Tfu_0985          CDS       T00265                                 

Definition
(GenBank) alpha amylase, C-terminal all-beta:Alpha amylase, catalytic subdomain
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
tfu  Thermobifida fusca
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tfu_0985
Enzymes [BR:tfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Tfu_0985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(1153825..1155642)
Genome map
AA seq 605 aa AA seqDB search
MGVRRSLAALLAALLGCATSLVALTVAASPAHAAPSGNRDVIVHLFQWRWKSIADECRTT
LGPHGFGAVQVSPPQEHVVLPAEDYPWWQDYQPVSYKLDQTRRGSRADFIDMVNTCREAG
VKIYVDAVINHMTGTGSAGAGPGSAGSSYSKYDYPGIYQSQDFNDCRRDITNWNDKWEVQ
HCELVGLADLKTSSPYVQDRIAAYLNELIDLGVAGFRIDAAKHIPEGDLQAILSRLKNVH
PAWGGGKPYIFQEVIADSTISTGSYTHLGSVTEFQYHRDISHAFANGNIAHLTGLGSGLT
PSDKAVVFVVNHDTQRYEPILTHTDGARYDLAQKFMLAHPYGTPKVMSSYTWSGDDKAGP
PMHSDGTTRPTDCSADRWLCEHRAVAGMVGFHNAVAGQGIGSAVTDGNGRLAFARGSAGY
AAFNATNTAWTRTFTTSLPDGVYCDVANGTFVDGVCDGPSYQVSGGKFTATVPANGAVAL
HVEAPGSCGPDGCGTPPGGGDDCTTVTARFHATVTTWYGQEVAVVGSIPELGSWQPAQGV
RLRTDSGTYPVWSGAVDLPAGVGFEYKYVKLNPDGTVEWEQGGNRIATVDDSGGGCSQNF
YDSWR
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgggagtgcgcagatccctggccgcgctgctcgcggccctgctgggttgtgccacgtcc
ctggttgcgctgaccgtcgcggcttcccccgctcatgccgcgccgtcaggcaaccgggac
gtcatcgtccacctattccaatggcggtggaagtcgatcgccgacgagtgccggaccacg
ctcggcccccacggcttcggcgcagtccaggtctccccgccgcaagagcacgtggtcctg
cccgctgaggactacccctggtggcaggactaccagccggtgtcctacaagctcgaccag
acccgccgcggcagccgggccgacttcatcgacatggtcaacacctgccgggaggcgggc
gtcaagatctacgtcgacgcggtcatcaaccacatgaccggcaccgggtccgcgggtgcc
ggtccgggcagcgcgggctccagctacagcaagtacgactacccgggcatctaccagagc
caggacttcaacgactgccgccgcgacatcaccaactggaacgacaagtgggaggtgcag
cactgcgagctggtcggcctcgccgacttgaagacgtcctccccctacgtccaggaccgg
atcgcggcctacctcaacgagctgatcgacctcggcgtggccgggttccgcatcgacgcc
gccaagcacatccccgagggcgacctgcaggcgatcctctcccgcctgaagaacgtccac
ccggcgtggggcggcggcaagccgtacatcttccaggaggtgatcgcggacagcacgatc
agcaccggctcctacacgcacctggggtcggtcaccgagttccagtaccaccgggacatc
agccacgcgttcgccaacgggaacatcgcccacttgaccggcttgggcagcgggctgacc
cccagcgacaaggccgtggtgttcgtggtcaaccacgacacgcagcgctacgagccgatc
ctcacccacaccgacggggcgcgctacgacctggcgcagaagttcatgctggcccacccg
tacggcacaccgaaggtgatgtccagctacacgtggtcgggtgacgacaaggcggggccg
ccgatgcactccgacggcacgacccggcccaccgactgctcggcggaccgctggctgtgc
gagcaccgcgcggtggcgggcatggtcggcttccacaacgcggtggccgggcagggcatc
gggtctgcggtgaccgacggcaacggccgcctggcgttcgcccgcggctccgccgggtat
gccgcgttcaacgcgacgaacaccgcgtggacgcgcacgttcaccacttccctgccggac
ggcgtctactgcgatgtggcgaacggcactttcgtcgacggggtgtgcgacggccccagc
taccaggtgtccggcgggaagttcaccgctacggtgcctgcgaacggcgcggtggcgctg
cacgtggaggcgcccggctcgtgcggcccggacgggtgcggtacgccgcctggtggcggg
gacgactgcaccacggtcacggcccggttccacgcgaccgtcaccacctggtacggccag
gaggtcgccgtggtggggtcgatccccgagctgggctcctggcagcccgcccagggggtg
cggctgcgcacggactcgggcacctatcccgtctggtcgggcgcggtggacctgcccgcc
ggggtcggtttcgagtacaagtacgtgaagctcaacccggacggcaccgtggagtgggag
cagggcggcaaccgcatcgccaccgtggatgacagcgggggcggctgttcccagaacttc
tacgactcctggcgctga

DBGET integrated database retrieval system