KEGG   Thermobifida fusca: Tfu_2593Help
Entry
Tfu_2593          CDS       T00265                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
tfu  Thermobifida fusca
Pathway
tfu00564  Glycerophospholipid metabolism
tfu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tfu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Tfu_2593
Enzymes [BR:tfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Tfu_2593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 3HCDH_N Pyr_redox NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AAZ56626
JGI: Tfu2593
UniProt: Q47LP6
LinkDB All DBs
Position
complement(3060800..3062617)
Genome map
AA seq 605 aa AA seqDB search
MPHRTRLPARGGKRRPLPPPGARKGGGDPAHQMTAARLGPQERDAALRAMADTELDVLVV
GGGIVGAGVALDAVARGLSVGLVEARDFASGTSSRSSKLIHGGLRYLEHLDFPLVREALT
ERGLLLSRIAPHLVRPVPFLFPLRSHWERPYIGAGVALYDALALSGTRTRGLPGHRHLSR
RAALRIFPALRRDALVGAVQYWDAQVDDSRYVVMVLRTAATYGAHIASRTQAVGFLREGE
HVTGARVVDLETGREFAVRAKQVVNAAGVWTDEIQEMVGGRGQIHVRASKGVHLVVPRDR
IHASSGLILRTEKSVLFVIPWGRHWILGTTDTAWDLDKAHPAASRTDIDYVLNRVNAVLK
TPLTRDDVEGVYAGLRPLLAGESEETSRLSREHTVAHPVPGLVLIAGGKYTTYRVMAKDA
VDAVAHGMGGGVPPSVTDRLPLVGADGYFALWNQRRILARRTGLHVSRIQHLLRRYGSLI
HEVLGLIAEQPDLKQPLTGADDYLRAEVVYAVRYEGARHLDDVLSRRTHIAIETWDRGLA
AAEEAAQLMAGPLGWDDAQIAREVEYYRARIEAERAAQEQDSDQEADAVQHGAPDIVPQA
TTVRV
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaccgcacgcggcttcccgcgagaggagggaagcggcgtcctctgcctccgccc
ggcgcccggaaaggaggaggggaccccgcgcaccagatgacggcagcacggttgggacca
caggaacgggacgccgccctcagggccatggccgacaccgaactcgacgtgctggtggtc
ggaggagggatcgtcggagcgggtgtcgctctggacgcggtggcgcgcggcctctccgtc
gggctcgtggaggcccgcgacttcgcttcaggaacctccagcaggtccagcaagctcatc
cacgggggcctgcgctacctggagcacttggacttccctctcgtccgcgaggcgctcacc
gaacgcggcctgctcctcagccggatcgccccgcacctggtgcgcccggtgccgttcctg
ttcccgctccgctcccactgggaacgcccctacatcggggcgggggtggccctctacgac
gcgctggccctgtccggcacccgcacccgcggcctgcccggccaccgccacctcagccgc
cgtgccgccctgcggatcttccccgcgctgcgccgcgacgccctcgtcggcgccgtgcag
tactgggacgcacaggtggacgactcccgctacgtggtgatggtgctccgcaccgccgcc
acctacggcgcgcacatcgcctcgcgtacccaggccgtcgggttcctgcgggaaggggag
catgtcaccggggcccgcgtcgtcgacctggaaaccggccgagagttcgcggtccgcgcg
aaacaggtggtcaacgcggccggggtgtggaccgacgagatccaggagatggtgggcggg
cgcggccagatccacgtgcgcgcctccaaaggcgttcacctggtggtgcctcgggaccgg
atccacgcatcctccgggctgatcctgcgcaccgagaagagcgtgctgttcgtcatcccg
tggggacggcactggatcctcggcaccaccgacaccgcatgggacctggacaaggcgcac
cccgcggccagccgaaccgacatcgactacgtgctcaaccgcgtcaacgcagtcctgaaa
accccgttgaccagagacgacgtggagggggtgtatgcggggctgcggccgctgctcgcg
ggggagtccgaggagacctcccggttgtcccgggagcacaccgtggcgcacccggtgccc
ggcctagtcctcatcgcgggcggaaagtacaccacctaccgggtcatggccaaggacgcg
gtggacgcggtcgcccacgggatgggcgggggagtgcccccgtcggtgaccgaccggctt
cccctggtgggcgccgacggctatttcgcgctgtggaaccagcgtcgcatcctcgcccgc
cgcaccggcctgcacgtgtcccggatccagcaccttctgcgccgctacggttccctcatc
cacgaagtgctgggactgatcgccgaacagccggatttgaagcagccgttgaccggcgcc
gacgactacctgcgtgccgaagtggtctacgcggtccgctacgaaggggcccgccacctc
gacgacgtgctcagccgccgcacccacatcgccattgagacgtgggaccgcggccttgcc
gcggctgaggaggcggcacagctcatggccggcccgctcggctgggacgatgcccaaatc
gcccgagaagtggagtactaccgtgcccggatcgaagcggaacgggccgcccaggagcaa
gacagcgaccaggaagccgacgcggtccagcacggtgccccggatatcgtgccgcaagcc
accaccgtacgggtctga

DBGET integrated database retrieval system