Theropithecus gelada (gelada): 112624811 Help Entry 112624811         CDS       T08041                                  Name (RefSeq) ubiquitin isoform X1   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism tge  Theropithecus gelada (gelada) Pathway tge03010   Ribosome tge04120   Ubiquitin mediated proteolysis tge04137   Mitophagy - animal tge04140   Autophagy - animal tge05012   Parkinson disease tge05022   Pathways of neurodegeneration - multiple diseases tge05167   Kaposi sarcoma-associated herpesvirus infection tge05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:tge00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     112624811   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     112624811  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     112624811    04137 Mitophagy - animal     112624811  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     112624811    05167 Kaposi sarcoma-associated herpesvirus infection     112624811   09164 Neurodegenerative disease    05012 Parkinson disease     112624811    05022 Pathways of neurodegeneration - multiple diseases     112624811  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:tge03011]     112624811    04121 Ubiquitin system [BR:tge04121]     112624811 Ribosome [BR:tge03011]  Ribosomal proteins   Eukaryotes    Large subunit     112624811   Archaea     112624811 Ubiquitin system [BR:tge04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    112624811 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Ribosomal_L40e Ubiquitin_2 Rad60-SLD_2 DUF2604 Ubiquitin_5 TBK1_ULD OTU1_UBXL Dsc3_N Motif Other DBs NCBI-GeneID:  112624811 NCBI-ProteinID:  XP_025241598 Ensembl:  ENSTGEG00000005120 LinkDB All DBs Position 5:complement(53029222..53029762) Genome browser AA seq 139 aa AA seqDB search MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN IQKESTLHLVLRLRGGIIEPSLCQLAQKYNRNQMICRKSVATPTTCAPRRRSNKALLSLK GSLLPRPCGPGASIKCPFR NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atgcagatctttgtgaagaccctcacgggcaaaaccatcacccttgaggtcgagcccagt gacaccattgagaacgtcaaagccaaaattcaagacaaggagggtatcccacctgaccag cagcgtctgatatttgccggcaaacagctggaagatggccgcactctctcagactacaac atccagaaagagtccaccctgcacctggtgttgcgcctgcgaggtggcattattgagcct tccctctgccagcttgcccagaaatacaaccgcaaccagatgatctgccgcaaaagtgtg gccacaccaacaacctgcgccccaagaagaaggtcaaataaggctcttctttccttgaag ggcagcctcctgcccaggccctgtggccctggagcctcaataaagtgtccctttcgttga

DBGET integrated database retrieval system