KEGG   Taeniopygia guttata (zebra finch): 100218765Help
Entry
100218765         CDS       T01082                                 

Definition
(RefSeq) pancreatic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00500  Starch and sucrose metabolism
tgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100218765
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     100218765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 100218765
NCBI-ProteinID: XP_002186645
LinkDB All DBs
Position
8
AA seq 513 aa AA seqDB search
MQVLLLLLAAAGLCWGQYNPNTFPKRTSIVHLFEWRWQDIAQECERYLAPNGFGGVQVSP
PNENIVITSPNRPWWERYQPISYKICTRSGNEQEFRDMVARCNNVGVRIYVDAVVNHMCG
AAGGSGTHSTCGSYFNTGKEDFPAVPYSGWDFNDGKCHTGSGEIENYGDANQVRNCRLSG
LLDLALDKDYVRSKIAEYMNNLIDMGVAGFRLDAAKHMWPGDIKAFLDKLHNLNTQWFSE
GTRPFIYQEVIDLGGEPITGSQYFGNGRVTEFKYGAKLGTVLRKWDGEKMAYLKNWGEGW
GFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSFRW
PRRFENGKDVNDWYGPPSNSDGSTKAVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDG
EPFSNWWDNGSNQVAFGRGNKGFIIFNNDDWNMNVNVQTGLPSGTYCDVISGQKENNRCT
GKQVFVSGDGKANFQINTDAEDPFIAIHVDAKL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtccttctcctcctcctcgcagccgcagggctttgctgggggcagtacaacccc
aacactttcccaaagagaacctctattgtgcatctcttcgaatggcgctggcaggatatt
gctcaggagtgtgaacgctacttagctcctaatggatttggaggtgttcaggtttcacct
ccaaatgaaaatattgtcattactagcccgaacagaccctggtgggaaagataccagccc
attagctacaagatctgcactcgatcaggaaatgaacaggaattcagagacatggtggcc
agatgcaacaatgttggagttcgtatctatgtggatgctgtcgtcaaccatatgtgtggt
gctgcaggtggctcaggcacacattctacctgtggaagctatttcaatactggaaaagaa
gattttccagctgtaccatactctggctgggatttcaatgatggcaaatgtcacactgga
agtggagaaattgaaaattatggtgatgccaatcaggttcggaactgtcgcttgagtggc
cttctggatctggccctggataaggactatgtgcgctcaaagattgcagagtacatgaac
aatctcattgacatgggtgtagcaggattccgacttgatgctgccaagcacatgtggcct
ggggacataaaagcgtttctggacaagctgcataatctaaacactcaatggttttctgaa
ggaactagacctttcatttaccaagaggtaattgacttgggtggagagcccatcacaggc
agccagtactttggaaatggccgagtgacagaattcaagtacggtgccaaactggggaca
gtgctccgcaagtgggacggagaaaagatggcctacttaaagaactggggagaaggctgg
ggctttgtgccttctgacagagccctggtctttgtggataatcacgacaaccagagagga
cacggggccggtggagcttctattctgaccttctgggatgccaggctctataagatggcg
gttggtttcatgcttgcccatccctatgggttcacacgtgtgatgtcaagttttcgctgg
ccaagacgttttgaaaatggaaaggacgtcaatgactggtatgggcccccaagtaactca
gatggctccacaaaggccgtcacaatcaacccggacacgacctgtggcaacgactgggtt
tgtgaacatcgctggcgtcaaatcaggaacatggttatcttccgtaacgtggtggatggt
gagcctttctccaactggtgggacaatggcagcaatcaagtggcttttggccgtggtaac
aaaggcttcatcatcttcaataatgatgactggaatatgaatgtcaatgtgcaaactgga
ctgccctctggtacctactgtgatgttatttctggacaaaaggagaataacagatgtact
ggaaagcaggtgtttgtttctggtgatggaaaggctaatttccagattaataccgatgct
gaagatccatttattgcaattcatgttgatgccaagttataa

DBGET integrated database retrieval system