KEGG   Taeniopygia guttata (zebra finch): 100222021Help
Entry
100222021         CDS       T01082                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    100222021 (HDAC4)
Enzymes [BR:tgu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100222021 (HDAC4)
Chromosome [BR:tgu03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100222021 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
7
AA seq 1089 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPPRVNHMPSSVDVSTALPLQVAPSSVPMDLRLDHQFSMP
VTEPTLREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLA
MKHQQELLEHQRKLEQHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCISSDPRFWYGKTQHSSLDQSSPPQSGVSGTYNHPVLGMYDSKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTGTADSACNSAPG
SGPSSPNNSSNNISTENGIAGSVTSIQAETSLAHRLVNREGSVTQLPLYTSPSLPNITLG
LPATGPSSAGQAQQDAERLAIPALQQRISLFPGTHLTPYLSTTALERDGGTAHNPLLQHM
VLLEQPTAQTPLVTDWYLSGLPLHAQPLVGGERVSPSIHKLRQHRPLGRTQSAPLPQNAQ
ALQQLVIQQQHQQFLEKHKQQFQQQQLHINKIISKPPEPARQHESHPEETEEELREHQAL
LEEPYGERATGQKEPPALASVVQVKQEPIESDEEEAEPQQELESGQRQAEQELLFRQQAL
LLEQQRIHQLRNYQASLEAAGMPVSFGGHRPLSRAQSSPASATFPMSVQEPPTKPRFTTG
LVYDTLMLKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVH
SEAHTLLYGTNPLNRQKLDSKKLLGSLTSMFVRLPCGGVGVDSDTIWNEVHSSGAARLAV
GCVIELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLNVSKIL
IVDWDVHHGNGTQQAFYNDPNVLYISLHRYDDGNFFPGSGAPDEVGTGAGVGFNVNMAFT
GGLDPPMGDTEYLTAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGY
LTKQLMGLAGGRVVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVFQQRANANAVH
SMEKVIEIHSKYWHSLQRFASTVGYSLVEAQKCENEEAETVTAMASLSVGVKPAEKRPED
EPMEEEPPL
NT seq 3270 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatgggctttctggcagagatcagccagttgagctgttg
aatccacctcgagtgaaccacatgcccagctctgttgacgtgagcacagccctgcccttg
caagtggcgccgagctcggtgcccatggacctgcggctggatcaccagttctccatgccg
gtgacggagccgacgctgcgggagcagcagctgcagcaggagctgctggccctcaagcag
aagcagcagattcagaggcagatcctgatcgcagagttccagcggcagcacgagcagctc
tctcggcagcatgaagcgcagctgcatgagcacatcaagcagcagcaggagatgctggcc
atgaagcatcagcaggagctgttggagcaccagaggaagctggagcagcaccgacaggag
caggagctggagaagcagcaccgagagcagaaactgcagcagctgaaaaacaaagagaaa
gggaaagagagtgcagtggcaagcacagaagtgaagatgaaattgcaggaattcgtgtta
aacaagaagaaggctctggcccaccggaatctcaaccactgcatatccagcgaccctcgc
ttctggtacgggaagacccagcacagctctctggaccagagctccccaccccaaagtggc
gtctccggcacctacaaccacccagtcctggggatgtacgattccaaagatgacttccca
ctcagaaaaacagcctctgagcccaacctgaagctgcgctccagactaaagcagaaggtg
gctgagaggaggagcagccccctcctgcgcaggaaggacgggcccgtggtgacggcactc
aagaagcgcccgctggatgtcacagggacggcggactctgcatgcaacagcgctcctgga
tctggtcccagctctccgaacaacagctccaacaacatcagtactgagaacggaattgca
ggatcagtcacgagtatccaagcagagaccagcctggctcacaggctcgtgaaccgcgag
ggctctgtgacacagctcccactctacacctcgccctcgctgcccaacatcacgctagga
ctgcctgccaccggcccctccagcgcaggacaagcgcagcaggacgcggagaggctcgca
attccagccttacagcagcggatctccttattccctggcactcacctcacaccctacctg
agcactacagcattggagagggatgggggaactgcacacaaccctctcctgcagcacatg
gtcctactggaacagccaactgcacaaacgcccctggtcacagactggtatctttcagga
ctgccgctgcacgcacagcccctggtgggtggagagagggtctccccttcgatccacaag
ctgcggcagcaccgcccgctcgggcgcacccagtctgctcccctgccccagaacgcccag
gccctccagcagctggtgatccagcagcagcaccagcagttcctggaaaaacacaaacag
cagttccagcagcagcagctgcacatcaacaagatcatctccaaacccccggagccggcg
cggcagcacgagagccaccccgaggagacggaggaggagctgcgggagcaccaggccctg
ctggaggagccctacggcgagcgggccacgggccagaaggagcccccggcgctggccagc
gtggtgcaggtcaagcaggagcccatcgagagcgacgaggaggaggcagagccgcagcag
gagctggagtccggccagaggcaggcggagcaggagctgctcttccgccagcaagccctg
ctcctggagcagcagcggattcaccagctgaggaactaccaggcgtcgctggaggcggct
ggcatgcccgtgtccttcgggggacaccggcccctgtcccgggcacagtcctcccccgcc
tcggccaccttccccatgtccgtgcaggagccacccactaagccaaggttcacaacaggg
cttgtgtatgacaccttgatgctgaagcaccagtgcacctgtggaaacaccaacagccac
cccgagcatgcaggcaggatccagagcatctggtccaggctccaggagacggggctgcgg
ggcaagtgtgagtgcatccgtggcagaaaggcgacgctggaggagctgcagacagttcac
tcggaagcccacacgctgctctacggcacaaaccctctgaacaggcagaaactggacagc
aagaagcttctaggttccctaacgtcaatgtttgtcaggctgccttgcggtggtgttggg
gtcgacagtgacaccatttggaacgaggtgcactcatcgggcgctgctcgcctggctgtg
ggctgtgtcatcgagctggtgttcaaagtggccacgggagaactgaagaatggatttgct
gttgttcggcccccgggtcaccacgcggaggagagcacacccatgggtttctgctatttt
aactccgtggcaattgcagccaagctgctccagcaaaggctcaacgtgagcaaaatcctc
attgtggactgggatgtccaccatgggaatggtactcagcaggccttctacaacgatccc
aatgtcctttatatctcactccatcgctacgatgatggcaacttcttcccaggcagtggc
gcaccggatgaggttggcacaggagcaggagttggtttcaatgttaacatggcatttact
ggtggtctggatccgcccatgggagacacagaatatttaactgccttcaggacagtagtg
atgcccattgccaacgagtttgccccagacgttgtgctggtgtcatctggtttcgatgct
gtggaagggcaccccacacccctgggaggatataatctgtcagcaaaatgcttcgggtac
ctgacgaagcagctgatgggcctggccgggggccgcgtggtgctggccctcgagggtggc
cacgacctcactgccatctgcgacgcctcggaggcctgtgtgtctgccctgctgggaaac
gagcttgaccctcttccagagaaagtgttccagcagagagcaaatgctaacgcagtgcat
tccatggagaaagtcatcgagatccacagcaagtactggcattccctccagcgttttgcc
tccacggtgggatattccctggtggaggcccagaagtgtgagaatgaagaggcggagaca
gtgacagccatggcatcgctgtcggtgggtgtgaagccagcggagaagagacctgaggat
gaacccatggaagaggagcctcccctgtag

DBGET integrated database retrieval system