KEGG   Taeniopygia guttata (zebra finch): 100224614Help
Entry
100224614         CDS       T01082                                 

Gene name
SETD2
Definition
(RefSeq) SET domain containing 2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100224614 (SETD2)
Enzymes [BR:tgu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100224614 (SETD2)
Chromosome and associated proteins [BR:tgu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100224614 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET SRI WW
Motif
Other DBs
NCBI-GeneID: 100224614
NCBI-ProteinID: XP_012426784
Ensembl: ENSTGUG00000000164
LinkDB All DBs
Position
2
AA seq 2498 aa AA seqDB search
MFPRLDCNREEENEGKPETVPRAGFIKGPVFKGVASSRFLPKGTKTKVNLEEQGRQKVSF
SFSLTKKTLPNRFLAALGNEKQNETPTPPAVPVPTDFNPKNKLDLGDTASSAEESSPPKP
KVELGKIHFKKHLLNVTAKPPPAPATPVTEPVAFAVDLPPTPPPPPPPPPPPASPMPVPG
ATAPLVTPMPALLLSPPGEAEAPVPREPSQALPREAVEPDAKQDPASRGSEERVTPPAPE
QTEVTPPKEDSHIGKEDEVSDGSKGAPVCSRRQGAKRKFSQSDGALQGSESDEDSVRTSS
SQRSHEQKISSTEKERDPRRSSASHRSDDVGKSSSRSRSDRDEKYLSYSKSERDSRYSSS
RSRSDRDRRRSRSHSRSRSDRSSRTSSSYSRSERSHYYDSDRRYHRSSPYRERSRYSRSY
ADSRARESSDSEDEYRRTHSRSSDSRRTSSHSSSSYRDSRSSYSKSDRDSKVESSHADVD
RRGRSSSKADRDSKRTSESEVSKRCSPLDELGYRKGTSHSKPDSNVNSSRYKSTPSKAPA
PKPDKFKSSFCCTESIEEIKSKSNSLDLETSCVKNNEIRVSSVKKLEREKTLSPLNQFND
SPALPKANESKAGLANSKSEELAANKGHDSVKEQEPFLRAKHDPLRMCFPTESSVNGSPE
GQDEGLATSSACKAEDVAASSDHGPGRSEASPAINTSPSYPLPSNGFESTDVSQEQELDD
SRVQSSECNSLFQEAEAPEPEQPEEAAPLPAVNVDPTNTDLNKLDEEVTHTLCDKTKEPV
FCYISDDATPGLYHSEVEIEAEPADLKMTSETFLDVQVEPQTVTCDYESAEDSHSKSAGE
DEHGHPSHKISLAVESSSRDSSQDGCSQRLQSDHPMLEESVSSKWDVPPPGVCQEPLQHS
EAEEMLELDAQHVDLGSAKGKLSFQNEHSYYSEVPLEHRSREVVEESAVSTEGAELDELR
VQSPGVSAERDEGSEPLVASAFPDTLYPSSDVIVTADDTEMVTQAPTCDSSGNALEFIPA
GHDDYSDSGDSNSEGGSEDSDTEDSDSDDGTPRKKLQSVVVVPKNSTIAMEESSPGSSRS
NRRFSDHWDDERPEPSRPYYEERSENMGSKGGPQVESRCSPRGMEKSPATSTELSRKELE
ELRADPCQAQSDGVDSTSQADLTADSHGKAGTEERLGLPDAVTMGRPMGRPEEQPFCIPE
SLESTDTSRHQMSSSKPDSRQGQGGLNQSGLGDYSRLDGFRAPEEMGAVGXDFSQQEKPS
STYQQPDSSFGMYSGYVYQPGPGAYPSSQSYWQGNGYWDARAASRASVVNYERIQGQVPD
SLTEDHEEFEEDERWDEECKPRFPSPSGKSQMPEQKEKGSVQAHEISSNSTKEPVPGGEK
KDEAKALEKNDVKERGPPKKRRPELESDSESDGDSGEKRKGKLEGEQVEPAPQDSSMVGR
LCIMDDFRDPQRWKEFAKQGKMPCYFDLIEENVYLTERKKNKSHRDIKRMLCECPPLSKE
ERAQGEVACGEDCLNRLLMIECSSRCPNGDYCSNRRFQKKQHADVEVILTEKKGWGLRAA
KDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFM
NHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSSNCRG
YLGGENRVSIRAAGGKMKKERSRKKDSVDGELEALLENGEGLSDKNQVLSLSRLMVRIET
LEQKLTCLKLIQNTHSQSCLKSFLECHGLSLLWIWMTELGDGRGSTANNLKLQLEIMKTL
ELLPIPTKNMLEESKVLPIIQRWAQTKTAVPQLSEGDGYSSENTSRAHTPLNTPELSAKQ
SVEGDTDTPKKLVFRRLKIISENSMDSAISDTTSELEGKEGKEDLDQLEAAPVEVMEEQQ
QQQIXQQDIKTAVEAPVESSKSQPAELEAEPEAEVKESNGAKLEEPMAMETPSQDEEEGV
SDVESERSQEQTDKIVDVSDLATRLLDSWKELKEVYRIPKKSQAEKESSAERGRDTGGLR
DQTPTPKNPILSRERDPERQSQSKERKRRRDSLSPPSSAYERGTKRPEDRYDTPASSKKK
VRPKDRNKLSTEERRKLFEQEVAQREAQKQQQQLQNLGMTSPLPYDSMGYGTPHHSFMGY
PPGYPMQAYVDPSNPNAGKVLLPTPSMDSMCSPAGYEHSQTLVGHTVEPALSTPQPVPVV
QHVATTMEVITPQYVAQSDAVVHQEANVAVLPVAAAGAVQSQSYGVWDSSQQPAVAVQQP
YSPAQSQPAIYYQGQTCQTVYGVTSPYSQTTPPIVQSYAQPGLQYIQGQQIYTAHPQGVI
VQPPTAVTTIVAAGQPQPIQQPELVVTNNLLDLPPPSPPKPKTIVLPPNWKTARDPEGKI
YYYHVVTRQTQWDPPTWDSPGDDASLEHEAEMDLGTPTYDENPMKLTHGVMNKELKYCKN
PEDLECNENVKHKTKEYIKKYMQKFGILYKPKEDTELE
NT seq 7497 nt NT seq  +upstreamnt  +downstreamnt
atgtttccccggctggattgcaatagagaagaagaaaatgagggcaaacctgaaacggtg
ccgagagccggttttatcaaaggccccgtgttcaaaggtgtcgcctcgagccgctttttg
cccaaaggcaccaaaaccaaggttaaccttgaggagcagggaagacaaaaagtgtctttc
agttttagtttaaccaagaaaactttacccaatcgattcctggctgctctgggaaacgag
aaacaaaatgaaactcccacccctccagcggttcccgttcccactgattttaaccccaaa
aataaactggacctgggcgataccgccagttcagccgaggaatcttcgcctccaaaaccg
aaggtagaattggggaagattcattttaaaaaacatttactgaacgtcacggcaaagcca
cccccagctccggcgacaccggtaacggaaccggtggccttcgccgtggatctccccccc
acgccgccgcctcccccacccccgccgccaccaccggcgtcaccgatgccggttcctgga
gccacggccccgctggtgacgccgatgccggcgctgctgctgtcgccgcccggcgaagcc
gaagcccccgtgccgagggagccgagccaggcgctgcccagggaggccgtggagccggac
gccaagcaggatccagcgtcgcgcggctcagaggaacgcgtgactccacctgcgcccgag
cagacagaggtaaccccgcccaaggaagattcccatattgggaaggaggatgaggtttct
gatggctcaaagggtgctcccgtgtgctcccggaggcagggagccaaaaggaagttctcc
cagtcggatggcgcgctgcagggctctgagtccgacgaggattccgtgaggacctcctcc
agccagcgatcgcatgagcagaagatctccagcacggaaaaggagagagatcccagacgg
agctccgcgtcccaccggagtgatgacgtgggcaagtcctcgtcgcgctccaggtcggac
agggatgagaagtacttgagctattccaaatcggagagagactcacggtactcgtcctcc
cgctcccgctctgacagagacaggaggcgaagccggtctcattcacgttcccgctccgac
cgcagctcccgaaccagctcctcctactcgaggtcggaacgctcgcattactacgactcc
gaccgccggtaccatcggagctccccgtaccgggaacggtcgcgctattctcggtcgtac
gcggacagccgggcgcgggagagctcggactcggaggacgagtacaggaggacacattcc
aggtccagcgactccaggcgtacatcctcccattcctcctcctcctacagagactcgaga
tcctcttactccaagtcggacagggacagcaaagtggagtcgtctcatgccgacgtggac
aggcgggggaggtcgtcttcaaaagcggatcgagattccaaaaggacttctgaaagtgaa
gtgtccaaaaggtgctctccccttgatgaactgggctatcggaaggggacatcccattcc
aagcccgacagtaatgtgaattcctcccgctataaatccaccccttccaaggcccccgca
ccaaagcctgataaatttaagagttctttctgttgtacagaatcaattgaagaaatcaag
tccaagtctaattctctagatttagagacctcttgtgtaaagaacaatgagatcagggtg
tccagtgtgaaaaagttggaaagggaaaagacactttctccattaaatcagttcaacgat
tctcccgctttgccgaaggccaacgagtccaaggcaggtttggcaaactcaaaatctgag
gaacttgcagcaaacaaaggccatgacagtgttaaggagcaagaaccgttcttaagggca
aagcacgatcccttaagaatgtgtttccccacagaatcgagtgtgaatggctccccggag
ggtcaggatgagggtctggcaacttccagtgcctgcaaagcagaggatgttgctgcatcc
tctgaccacggcccgggtcggtcggaagcatcgcctgcaatcaataccagcccatcatat
ccgttgccatccaatgggtttgagagcacagatgtgtcccaagaacaagagctggatgat
tcccgggtccagtctagcgagtgcaacagcctgttccaggaagcggaggctccggagccg
gagcagccggaggaagccgcccctctccctgccgtgaatgtagatcccactaacactgac
cttaacaagttggatgaggaggtgactcacactctgtgtgacaaaaccaaagaacctgtt
ttttgctacatttctgatgatgccacccctggtttgtaccactcggaagtggaaatcgaa
gcggaacctgcggatttgaaaatgacatccgagactttcctggacgtgcaggtggagcca
cagacggtgacgtgtgattacgagagcgcggaggattcccattccaagtctgctggggag
gatgaacacggccatccttctcataaaatcagcctggcagtggaaagctcgagtagggat
tcctcccaggatggctgttcccagaggctccagtcagatcatcccatgctggaggaaagt
gtctcttccaaatgggatgtgcccccaccgggtgtgtgccaggagccactccagcattcg
gaagccgaagagatgctggagttggatgctcagcacgttgatcttggctcagcaaaaggc
aagttgtcgttccagaatgaacattcctactattcggaagtgccgctggagcaccgcagc
agagaggtcgtggaagaaagtgctgtttccacagagggagctgagctggatgagctgagg
gttcagtctcctggcgtatcggcggagagggatgagggaagcgagcccttggtggcctca
gcttttccagacactttgtatccctcctccgatgtcatcgtcacagcagacgacacggag
atggtgacccaagccccaacgtgtgacagcagcggcaatgccttggaattcattcctgct
ggccacgacgattattccgactcgggggacagcaacagcgaggggggcagcgaggacagt
gacacggaggactcggattccgacgatgggacgccgcggaagaagctccagtcagttgtg
gtggttcccaagaactccaccatagccatggaggagagcagcccaggctcctcccggagc
aaccggcgcttctccgaccactgggatgatgagcgccccgagcccagcaggccctactat
gaggagaggtcagaaaatatggggagtaaaggtggtccccaggtggagagcaggtgttct
cccagagggatggagaagagtccggcaacctccacagagctgagcaggaaggagctggag
gagctgcgggcggatccgtgccaggcccagagcgatggtgtggacagcacgagccaggcg
gacctcacggccgattcccacggcaaagccggcacggaggagaggctggggctgccggac
gccgtgaccatgggaaggcccatgggccggccggaggagcagcccttctgcatcccggag
agtttggaaagcaccgacacatcccggcaccagatgagctcttccaagcctgacagtcgg
caagggcagggcgggctgaaccagtccggccttggagactactccaggctggatggtttc
cgtgccccggaggagatgggtgccgtgggcngggacttctcccagcaggagaagcccagc
agcacctaccagcagccggacagcagctttgggatgtactcaggctacgtttaccagccg
ggcccgggagcctatcccagctcccagagctactggcaaggcaacggttactgggatgcg
agggcagccagcagagcctccgtggttaactacgaacgcatccagggccaggtgccggac
tccctcacggaagaccacgaggagttcgaagaggatgagcgttgggatgaggagtgcaaa
ccccgctttcccagcccctctggaaaatcccagatgcccgagcagaaggaaaagggctcg
gtgcaggcacacgagatcagcagcaattccaccaaggagccagtgccgggcggggagaag
aaggatgaggcgaaagctttggaaaaaaacgacgtgaaggaacgaggcccaccgaaaaaa
aggcggccagagttggagagcgactcggagagcgacggcgactccggggagaagaggaag
gggaagctggagggggagcaggtggagccggcgccgcaggattcctccatggtgggcagg
ttatgcatcatggatgatttcagggacccccagcgctggaaggagtttgccaagcagggg
aagatgccctgttactttgacctcatcgaggagaacgtctacttgacagagaggaagaag
aacaaatcccaccgggatatcaagcggatgctgtgcgagtgtcccccgctgtccaaggag
gagcgggcccagggggaggtggcctgtggagaagattgtctcaatcgcctgctcatgatt
gagtgctcctcccggtgtccaaacggtgactactgctccaaccggcgcttccagaagaaa
cagcacgcggacgtggaggtgatcctgaccgagaagaagggctgggggctcagagctgcc
aaggacctgccatccaacacttttgtcttggaatactgtggggaagtgctggatcacaag
gaattcaaggctcgggtgaaggaatatgcccggaacaagaacatccactattatttcatg
gccctgaagaatgatgagatcatcgacgccacccagaaaggaaactgctcccgcttcatg
aaccacagctgtgagccaaactgtgagacccaaaagtggacagtgaatgggcagctccgg
gttgggtttttcaccaccaagctggtcccgtcgggctcggagctgacgtttgattaccaa
ttccagagatacggcaaagaggcccagaaatgtttctgtggctcctccaactgccggggg
tacctgggtggggagaacagggtcagcatccgcgcggctggaggcaagatgaaaaaggag
cgctcccggaaaaaggactcggtggatggggagctggaggcgctgctggagaacggggag
ggtctctctgataaaaaccaggtgctcagcttgtcccggctcatggtgcggatcgaaacc
ctggagcagaaactcacctgcctcaaactcatccagaacacgcactcgcagtcctgcctc
aagtccttcctggagtgtcacggcttgtccctgctctggatctggatgacggagctgggc
gatggcagaggaagcacggccaacaacctgaagctgcagctggagatcatgaagaccctg
gagctgctgcccatccctaccaagaacatgctggaggagagcaaggtgctgcccatcatc
cagcgctgggctcagaccaagacggcggtgccgcagctcagcgagggcgacggatactcc
agcgagaacacgtcccgggcacacaccccgctcaacaccccggagctctcggccaagcag
agcgtggaaggtgacacggacacccccaagaagttggtgttccgcaggctgaagatcatc
agtgagaacagcatggacagcgccatctcggacaccaccagcgagctggaagggaaggag
ggcaaggaggacctggaccagctggaggcagccccagtggaggtgatggaggagcagcag
cagcagcagatcnagcagcaggacatcaaaactgctgtggaggcgccggtggagagcagc
aaatcccaacctgcggagctggaggccgagcccgaggcggaggtcaaggagagcaatgga
gcgaagctggaggagcccatggccatggaaacgccgtcgcaggatgaagaggaaggagtt
tccgatgtggagagcgagaggagccaggagcagacggataaaatcgtggatgtgagcgac
ttggccaccaggctgctcgacagctggaaggagctcaaggaggtttatcgcatcccgaag
aagagccaagcagaaaaggagagcagtgctgagcgtggcagagacacgggcgggctccgg
gatcagacccccactcccaagaaccccatcctgagccgagagcgggacccagagcggcag
agccagagcaaggagaggaagagacgcagagattccctgtcccctccgtcctcggcctac
gagcggggcacaaagaggccggaggacaggtacgacaccccagcgtcttccaagaagaaa
gtccgtcccaaggaccgcaacaagctgtccacggaggagcgccggaagctcttcgagcag
gaggtggcccaacgggaagcccagaaacaacagcagcagctccaaaacctgggaatgaca
tccccgcttccctacgactccatgggctacggaacaccccaccacagcttcatgggatac
cccccagggtaccccatgcaggcctacgtggaccccagcaaccccaacgccggcaaggtg
ctgctgcccacgcccagcatggactccatgtgctctccggcgggatacgagcattcccag
actttggtggggcacacggtggagccggccctgagcacccctcagccggtgcccgtggtg
cagcacgtggccaccaccatggaggtgatcacgccgcagtacgtggcgcagagcgacgcc
gtggtgcaccaggaggccaacgtggccgtgctgccggtggccgcggccggggcggtgcag
agccagagttacggggtgtgggattccagccagcagcccgccgtggccgtgcagcagccc
tactccccggcccagtcccaacctgccatctactaccagggccagacctgccagaccgtc
tacggagtgacctcgccctactcgcagaccaccccgcccatcgtccagagctacgcccag
ccaggtctccagtacatccagggccagcagatctacacggctcacccacagggagtcatc
gtgcagccccccacggccgtcaccaccatcgtggcggccgggcagccccagcccatccag
cagccagagctggtggtcaccaacaacctcctggatctgcctccgccttcccctcccaaa
cccaaaaccatcgtcctccctcccaactggaaaacagcccgggatcctgaggggaagatc
tactactaccacgtggtcaccagacaaacccagtgggatcccccaacctgggacagcccc
ggggacgacgccagcctggagcacgaggccgagatggacctcgggacccccacgtacgac
gagaaccccatgaagctgacccacggcgtgatgaacaaggagctcaagtactgcaagaac
cccgaggacctggagtgcaacgagaacgtcaaacacaaaaccaaggaatacatcaagaag
tacatgcagaaattcgggatcctctacaagcccaaagaggacacggagctggaatag

DBGET integrated database retrieval system