KEGG   Taeniopygia guttata (zebra finch): 100225647Help
Entry
100225647         CDS       T01082                                 

Gene name
SETD1B
Definition
(RefSeq) SET domain containing 1B
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
tgu  Taeniopygia guttata (zebra finch)
Pathway
tgu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:tgu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100225647 (SETD1B)
Enzymes [BR:tgu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100225647 (SETD1B)
Chromosome and associated proteins [BR:tgu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100225647 (SETD1B)
   HMT complexes
    COMPASS/SET1 complex
     100225647 (SETD1B)
    COMPASS/SET1 complex (yeast)
     100225647 (SETD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 RRM_5
Motif
Other DBs
NCBI-GeneID: 100225647
NCBI-ProteinID: XP_002193972
Ensembl: ENSTGUG00000006093
LinkDB All DBs
Position
15
AA seq 2004 aa AA seqDB search
MSFRETKAGEKAKHPEDHGKKQSSSWINGMENSTQASTSVEKRNHHWRSYKLIIDPALKK
GQHKLYRYDGQHFSMPNSGIAPVDCVRDPRIGRIWTKTKELELSVPKFKIDEFYVGPVPP
KQVTFAKLNDNIRENFLADMCKKYGEVEEVEILYNPKNKKHLGIAKVIFATVKGAREAVQ
HLHNTSVMGNIIHVELDTKGETRMRFYELLVNGLYTPQTLPVGTEQDVSPTGNEALQLTD
SLKRLKDSSLSSAGSSVTPNSSTPFSHDTAYSSCRQDTPNSYSQFTPQSQGTPHTPRLGT
PFSQDSTYSSRQTTPVYHFGQDSGYKPRRHETKFMDAYNRRPGHHYMHNSAGVFRGTEHQ
FSTFKSHQQEPVQFSHTPPLSHSSSSSYKSAFSPYQAPAVFPQSDEQPFPQTSRETEYRR
PAPPPTEMVVESSAAPSIDFVPVKEKPEEPPPLPDSNSVPEPSTASFSQTPERSETPGTP
TMETEMQHNSLDSRIEMLLKEQRTKLPFLNEHDSDNEIRMEGSPISSSSSQLSPIPTYGS
NSQPGFRGQTPSSRPSSTGLEDISPTPLPDSDDDEPIPGTASLSQNSRGTSEASMTPIDQ
LSRTSKTETLEVKEMVPGDQTPTSEKMDEGQHSSGEDMEISDDETNPAPITSAECAKTIV
VNSSVSNTAVMAPSIPPLPPPGFPPLPPPPPPQPGFPMPPPLPPPPPPTHPAVTVPPPPL
PAPPGVPPPHILPPLPPFHPGMFPVMQVDMISVLGNQWGGMPMSFQMQTQMLSRMMQAQN
TYQYPPFMTGRMQFVNLPPYRPFSMGAALARGQQWPPLPKFDPSVPPPGYEPKKEDPHKA
TVDGVLLVIVKELKAIMKRDLNRKMVEVVAFRAFDDWWDKKERLAKASLTPVKSGGELEE
KPKPKDRMASCLLENWNKGEGLGYEAIGLGIGLRGAIRLPSFKVKRKEPPEAASAGDQKR
IRPSTSVDDEDEESERDRDASDTTSDLSKKDAEAVGLRRRPARPLELDSEGEEGDETSGK
EEESSSEKEEEQEEDGGLVKAAPGKEEEEDEEDEDDEDEDDDEDEDEDDEEETGIDTSDK
EEEQDSEEDVASPSSSKAEAESSDESEDSSEFESSSDSDDEDEEDDDDEDEEEEEEEEVA
EDQGREAMVAEPEHEPASHELPDDERETILDLYPVDDYMDATGLGLAEPALAVKDEGNEE
IKAGENECGQVLGASVAAETLKHLVMERDHETKLALSPICRPEEESEPTSMLEPEVQECP
KPESQDEEAALCISAPGAVFGEPLPSKSSFFGKSEESSLEGRVKAKPPSAAEEDERLPRT
PGREVMIHLETETLLLPAHKVPSSMLPLPSTPGKEESLVPPEKFPEQLMVTKTSVEEEIP
RTPGRDILAKSSHPLTKSQSTDTVPATPGSDAPLTGSSLTLSSPQVPGSPFSYPSQSPGI
NSGIPRTPGRDFNFTPTFPEAGATIPCLLPGKKQSEDELEEKTFKEPLGASLTISMNSVP
SPLPFASPPQADFHMDMGLPPDEPIPVAALPCMHGDGRMPIEECKAEVKPVLLSPEVPPG
ASILPPPPPPSVLPKRRPGRPRRSPPSVLSLDVYSGKTIEPPPMPVTLVEGAVGKELLSG
HPDAYYGLKDPEAVTLDFRNDGFHEKIAAETVAEKLPFKELENQWNEDFKEEEAHAKPKR
QWRRQKKTSEELPAIPSPEYSPPQPQFRPRSEFEEMTILYDIWNGGIDEEDIKFMCITYD
RLLQQDNGMDWLNDTLWVFHPSTSFSTPKKKKRDDGMREHVTGCARSEGYYKIDKKDKLK
YLNNSRAFAEEPPADTQGMSIPAQPHASTRAGSERRSEQRRLLSSFTGSCDSDLLKFNQL
KFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSY
MFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSKQHINVNEEITYD
YKFPIEDVKIPCLCGSENCRGTLN
NT seq 6015 nt NT seq  +upstreamnt  +downstreamnt
atgtctttccgagagaccaaggcgggggaaaaagccaagcaccctgaagatcatggcaaa
aagcagagttcaagttggatcaacggaatggagaacagcacgcaagccagcacttctgtc
gagaaaagaaatcaccattggagaagttacaagttgattattgacccggctctgaaaaaa
ggacagcacaaactctaccgttacgatgggcaacatttcagcatgccgaactcggggatc
gctcctgtggattgtgtcagggatcccagaatagggcgaatatggaccaaaactaaggag
ttggagctgtctgtccccaaattcaagattgatgaattttacgtggggccagtgcctccc
aagcaggttacctttgccaagctgaatgacaacatccgtgaaaactttttggccgacatg
tgcaagaaatacggcgaagtggaagaggtggagattctctacaaccccaagaacaagaag
cacctgggcattgccaaagtcatctttgccactgtcaagggtgcccgggaggctgtgcag
caccttcacaacacttctgtcatgggcaacatcatccacgtggagctggatacaaaaggt
gaaacccgcatgagattctatgaactgctggttaatggtctttacactcctcagaccctc
cctgtaggcaccgaacaggacgtgtccccaactgggaacgaagctctccagttgacggac
tccctgaagcgcttgaaggacagttccctttcttccgcaggatcctccgttaccccaaac
agcagcacgcccttttcccatgacactgcctattccagctgccggcaagacaccccaaac
tcctacagccaattcaccccacagtcccaaggaacaccccacaccccgcgcctggggacg
ccgttctcccaggattccacctactccagccgacagaccacgcctgtgtaccattttggg
caggacagtgggtacaaacccaggagacatgagacgaaatttatggatgcgtacaaccgt
cgcccgggacaccactacatgcacaactcggcaggggtgttccgaggcaccgagcatcag
tttagtacattcaaatcccatcagcaggagccagttcagttctctcacactcctcccctg
agccactctagttcttctagctataaatctgccttctccccctatcaagcaccagctgtt
tttccccaatctgacgagcagccgtttccccaaacttcccgggagacagagtaccggaga
cctgcaccacctcccaccgagatggttgtggaaagcagcgctgccccgagcatcgatttt
gtcccagtgaaggagaaaccggaggagcctccgcccttgcccgactcgaactctgttcca
gaaccgagcacagcatccttctctcagactccggagaggagcgagacccctggcaccccc
accatggagactgagatgcagcataacagtttagactcaaggattgagatgctcttaaaa
gagcagagaacaaaattaccctttcttaacgagcatgactcagataatgagatccgaatg
gaaggtagccctatttcctcctcttcttcccagctctcccccatcccaacatacggttcg
aactctcagcctggtttcaggggtcagacgccttcctcgcgcccttccagcacaggcttg
gaggacatcagccccacacccttacctgactctgatgatgatgagcccatacctggcaca
gcttctctgagtcagaattcccgggggacatcggaggccagcatgactcccattgatcag
ctgagcaggacctccaaaactgagaccttggaggttaaagaaatggtgcctggtgaccag
actccaacatcggaaaaaatggacgagggtcagcattcctcaggggaggacatggaaatc
tctgacgatgagaccaaccctgcgcccatcaccagcgcggaatgtgccaaaaccattgtg
gtgaactcctccgtcagcaacacggccgtgatggccccgtccatccccccgctgccaccg
ccgggattccctcctcttcctcctcctccgcctccacagccgggcttcccgatgcccccg
ccgctgcctccgccgccgccacccacccacccggccgtcaccgtgcccccgccgccgctg
cccgccccgcccggggtccctccgccccacatcctgcccccgctgcccccgttccacccc
ggcatgttcccggtcatgcaggtggatatgatcagtgtcctgggcaaccagtggggtggc
atgcccatgtccttccagatgcaaactcagatgctgagccgcatgatgcaggcacagaac
acgtaccagtacccacctttcatgacgggccggatgcagtttgtgaatcttcctccctac
cgcccgttctccatgggagccgctctcgcccgcgggcagcagtggccgcccctgcccaag
ttcgacccctcggttccacccccgggttatgagccgaagaaggaagatccccacaaagcc
acggtggatggagttctcctggtcatagtgaaggaattaaaggccataatgaaaagggac
ctgaatcgcaagatggtcgaagtggtggcgttccgggcgtttgatgactggtgggacaag
aaggaacgtctggcaaaagcgtctctcactccagtgaagtctggaggagagctggaggag
aagccaaagccgaaggatcgaatggcctcttgtctcttggagaactggaacaaaggagaa
gggctgggctatgaggccatcggcctgggcattggcttacgaggggccatccgcctgcca
tccttcaaggtgaaaagaaaggagccacctgaagctgcctcagcgggagatcagaagaga
atccggccttctacatctgtggatgatgaagatgaagagtcggagagggacagggatgct
tctgacacaacatctgacctgtcaaagaaggatgcagaggcagtggggctgcgacggcga
ccagcgaggccattggagctcgacagcgagggagaggagggagatgagacgtcagggaaa
gaggaagagtcctcatcagagaaggaagaggagcaggaagaagatggaggcttggtgaaa
gcagcacctggcaaggaggaagaggaggatgaggaggatgaagatgatgaggatgaagat
gatgatgaagatgaggatgaagatgatgaggaggagacaggcatagacacaagtgacaag
gaggaggagcaggactccgaggaggatgtagcaagtccctcgtcttccaaggctgaagct
gaatcatctgatgagagtgaggactcctctgaattcgagtcaagttctgactcggatgat
gaagatgaggaggatgatgatgatgaagatgaggaggaagaagaggaggaagaggtggct
gaagatcaaggcagagaagccatggttgctgagccagagcatgaacctgctagtcatgag
cttcctgatgatgagagggagactattttggacctgtatcctgtggatgactacatggat
gcaacaggcttgggacttgccgagccagctttggcagtgaaagatgaaggcaatgaagaa
atcaaggcaggggaaaatgagtgtggccaagtcctgggagcttctgttgctgctgaaact
ctgaaacatttggttatggaaagagaccatgagacaaagcttgcactctctcccatctgt
aggccagaggaagagtctgaacccacttccatgctggagccagaggtacaggaatgtcca
aagcctgaatctcaggatgaggaggcagctctctgtatctctgctccaggggcagtcttt
ggagaacctctgcccagcaaaagcagcttctttggcaagtctgaggagagcagcttggaa
ggccgagttaaagcaaagccgccgtcggcagcggaggaggacgagcggctgccgcgcacg
cctgggcgggaggtgatgatccacttggagactgagactctcctgctgccagcccacaag
gtgccatcctccatgcttcccttgccatcaactcctggcaaagaagaatctttagtccct
ccagaaaagttccctgaacaattaatggtgaccaaaacatctgtggaagaggagattcct
aggactcccgggcgggacattttggccaagtcttcacaccccctcacgaagtcgcagagc
acggacactgttccagccacgccaggaagtgatgctccccttacaggaagcagcttgacc
ctcagttcccctcaagttccagggagccccttttcctacccatcccaatctcctggcatt
aatagtggcattcctcggactcctgggagagatttcaatttcacgcctactttcccagag
gctggtgctaccattccttgccttctgcctggcaagaagcagtcagaggatgagctcgaa
gagaaaaccttcaaagagcctcttggtgcttccctaacgatcagcatgaacagtgttcct
tcccctctcccctttgccagccccccgcaggcagatttccacatggacatgggtttgcca
cctgatgagccaatacctgtagcagccctgccgtgcatgcatggagatggaagaatgccc
atcgaggaatgcaaggcagaagtaaaacctgttttgctctccccagaagtaccccctggg
gcttctattcttcctcccccaccaccaccttctgttcttcccaaaaggaggccgggtcgg
ccgaggcggtcgccaccttctgtcctctcgctggatgtgtactcgggcaaaaccatagaa
cctcctcccatgccagtgaccttggtggaaggtgctgtgggcaaagagctgttgagtgga
catcctgatgcctactatggactgaaagaccctgaagccgtcaccctggacttcaggaat
gacggtttccacgagaaaatagcagctgagacagttgcagagaaactgccattcaaggaa
ctggagaaccagtggaatgaagacttcaaggaagaagaagctcacgcaaaacccaagcgg
cagtggcggaggcagaagaagacatctgaggagctgccagcgatcccttcccccgagtac
tccccgccccagccgcagttcaggccgcgctccgagtttgaggagatgaccattctgtat
gacatctggaacggaggcatagacgaggaggatatcaaattcatgtgtatcacatacgac
cgcttgttacagcaggacaatggtatggactggctcaatgacaccctgtgggttttccat
ccttctaccagcttttctacccccaagaagaagaagcgggatgacgggatgcgggagcac
gtgacgggctgtgcacgaagcgaaggctattacaaaattgataagaaggacaaactcaaa
tacctcaacaatagccgagcttttgcagaggagcctccagctgacacacagggtatgagc
atccctgcccaacctcacgcttccacccgggctggttccgagaggcgatcagagcaacgc
aggctcctctcctccttcactggtagctgcgacagtgacctgctcaagttcaaccagctc
aagttccggaagaaaaaactaaaattctgcaagagccacattcacgactggggtcttttt
gctatggagcccattgcagctgacgagatggtgatcgagtacgtgggtcagaacatcagg
caggtcattgctgacatgcgtgagaagcgatacgaggatgagggcattggcagcagttac
atgttcagagtcgaccacgacaccatcatcgatgccaccaaatgcgggaacttcgccagg
tttatcaatcacagctgcaatccaaattgttacgctaaagtgatcacggtggagtctcaa
aagaagatcgttatctactccaagcagcacatcaatgtgaacgaggaaattacctacgac
tacaagtttccaattgaggatgtaaaaatcccgtgtctctgtggctctgagaactgcagg
ggaaccctgaactga

DBGET integrated database retrieval system