KEGG   Thermococcus sp. 4557: GQS_07090Help
Entry
GQS_07090         CDS       T01588                                 

Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
the  Thermococcus sp. 4557
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:the00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GQS_07090
Enzymes [BR:the01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     GQS_07090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1358218..1359591
Genome map
AA seq 457 aa AA seqDB search
MARKVLVALLVLLVFLSVSAVPAKAETLENGGVIMQAFYWDVPGGGIWWDTIAQKIPDWA
SAGISAIWIPPASKGMSGGYSMGYDPYDYFDLGEYYQKGTVETRFGSKQELVNMINTAHA
YGIKVIADIVINHRAGGDLEWNPFVGDYTWTDFSKVASGKYTANYLDFHPNEVKCCDEGT
FGGYPDIAHEKSWDQYWLWASQESYAAYLRSIGIDAWRFDYVKGYGAWVVKDWLNWWGGW
AVGEYWDTNVDALLNWAYNSNAKVFDFPLYYKMDEAFDNNNIPALVDALKNGGTVVSRDP
FKAVTFVANHDTDIIWNKYPAYAFILTYEGQPTIFYRDYEEWLNKDRLNNLIWIHDHLAG
GSTDIVYYDNDELIFVRNGYGDKPGLITYINLGSSKAGRWVYVPKFAGSCIHEYTGNLGG
WVDKWVYSSGWVYLEAPAHDPANGQYGYSVWSYCGVG
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggccaggaaggtgttggtggcacttctcgtgcttctggtctttctcagcgtctcggca
gttcctgcaaaggcggaaaccctcgagaacggcggcgtcataatgcaggccttctactgg
gacgtcccgggcgggggaatctggtgggacacgatagcccagaagatacccgactgggcg
agcgcagggatttcggcgatatggattccccctgcgagcaagggcatgagcggcggctac
tcgatgggatacgacccctacgattattttgacctcggtgagtactatcagaagggaacc
gttgagacccgcttcggctctaaacaggagctcgtgaacatgataaacaccgctcacgcc
tacggcataaaggtgatagccgacatagtcatcaaccaccgcgccggcggcgacctggag
tggaaccccttcgtcggggactacacatggacggacttctcgaaggtcgcgtcgggcaag
tacaccgccaactacctcgacttccaccccaacgaggtcaagtgctgcgacgagggtacc
ttcggtggctatcccgacatcgcccacgagaagagctgggaccagtactggctctgggcc
agccaggagagctacgcggcctacctcaggagcatcggcatcgacgcctggcgcttcgac
tacgtcaagggttacggagcgtgggtcgtcaaggactggctgaactggtggggcggctgg
gcagttggagagtactgggacaccaacgtcgatgcgctcctcaactgggcctacaacagc
aacgccaaagtcttcgacttcccgctctactacaagatggacgaggccttcgataacaac
aacattccggccctcgtcgatgccctcaagaacggcggcaccgtcgtcagccgcgaccca
ttcaaggcggtgaccttcgtcgccaaccacgacaccgacataatctggaacaagtacccg
gcctacgccttcattctcacctacgagggccagccgacaatattctaccgcgactacgag
gagtggctcaacaaggacaggctcaacaacctcatctggatacacgaccacctcgccggg
ggaagcaccgacatcgtctactacgataacgatgaactcatcttcgtcaggaacggctac
ggggacaagccggggcttataacctacatcaacctcggctcgagcaaggccggaaggtgg
gtctacgttccgaagttcgcaggctcgtgcatacacgagtacaccggcaacctcggcggc
tgggtggacaagtgggtttattcgagtggctgggtctacctcgaggccccggcccacgac
ccggccaacggccagtacggctactccgtctggagttactgtggggtgggctga

DBGET integrated database retrieval system