KEGG   Thermococcus sp. 4557: GQS_09490Help
Entry
GQS_09490         CDS       T01588                                 

Gene name
rbcL
Definition
(GenBank) ribulose bisophosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
the  Thermococcus sp. 4557
Pathway
the00630  Glyoxylate and dicarboxylate metabolism
the01100  Metabolic pathways
the01120  Microbial metabolism in diverse environments
the01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:the00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GQS_09490 (rbcL)
Enzymes [BR:the01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     GQS_09490 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N LigA
Motif
Other DBs
NCBI-ProteinID: AEK73792
UniProt: G0HNE1
LinkDB All DBs
Position
1790529..1791863
Genome map
AA seq 444 aa AA seqDB search
MVEKFDEIYDYYVDKAYEPNKKRDIIAVFRITPAKGYTIEAAAGAVAAESSTGTWTTLYE
WYEKERWADLSAKAYDFHDMGDGSWIVKIAYPSHAFEDGNMPGFLASIAGNIFGMKRVEW
LRLEDIYLPERFLRNYPGPNFGIEGVRKKLEIYDRPLYGVVPKPKVGYSPEELYKLANDL
FLGGADYIKDDENLTSPWYNRFEERVKIVTKAMERAENETGEKKTWFANITAPILEMEER
LEILADYGVPHAMIDVVVLGWGVLDYIRELADDYGIALHAHRAMHTAFARNPYHGISMFV
LAKLYRLIGVDQLHIGTAGAGKMEGEKWEVIQYKRIITEDHYVPDENDVFHLEQKFYHIK
PVFPTSSGGLHPGNIQPVIDALGKDIVLQLGGGTMGHPDGPKAGAMAVRQALDAIMQGIP
LDEYAKSHRELARALEKWGHVTPV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggtagagaagtttgacgagatatacgactactacgtggacaaggcctatgagcccaat
aaaaagagggatatcatagccgtgttccgcataacccccgcgaagggctacaccatcgag
gcggccgccggtgcagtcgccgccgagagctcaactggaacctggacgacgctctacgag
tggtatgagaaggagaggtgggccgacctttccgccaaggcctacgacttccacgacatg
ggcgacggcagctggatagtcaagatcgcttatccctctcacgcctttgaggacggaaat
atgccgggcttcctcgcgagcatagcgggcaacatcttcggaatgaagcgcgttgagtgg
ctccgcttggaggatatataccttccggagaggttcctccgcaactaccccggtccgaac
ttcggtatcgaaggcgtcagaaagaagctggaaatatacgacaggccgctctacggtgtc
gtcccgaagccgaaggtcggctactctccggaggaactttacaagctcgccaacgacctc
ttcttgggtggagctgattacatcaaggacgatgagaacctcacgagcccctggtacaac
cgcttcgaggagagggtgaagatcgtcacaaaggctatggagagggccgagaacgagacc
ggcgagaagaagacatggttcgccaacattacggcccccatactggagatggaggaaagg
cttgagatacttgcagactacggagttccacatgcaatgatcgacgtcgtcgttctggga
tggggcgttctcgactacataagagagctggcagatgactacggcatcgcgctgcacgcc
cacagggccatgcacacagccttcgccaggaacccgtaccatggcatatcgatgttcgtc
ctggcgaagctctaccgccttataggcgttgaccagctccacatcggaaccgccggtgcg
ggcaagatggaaggggagaagtgggaggtcatccagtacaagaggataatcacggaagac
cactacgttccggacgagaacgacgtcttccatcttgagcagaaattctaccacatcaag
cccgtcttcccgacgagctccggcggcctccaccccggcaacatccagccggtcatagac
gccctcggaaaggacatcgtcctccagctcggcggtggaacaatgggtcatcctgacgga
ccgaaggccggagcgatggccgtcagacaggccctcgacgccatcatgcagggcatcccg
ctcgacgagtacgccaagagccacagggaactcgccagggccctcgaaaagtggggccac
gtcaccccggtctga

DBGET integrated database retrieval system