KEGG   Tarenaya hassleriana (spider flower): 104814575Help
Entry
104814575         CDS       T04125                                 

Definition
(RefSeq) hexokinase-1-like
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:thj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104814575
   00051 Fructose and mannose metabolism
    104814575
   00052 Galactose metabolism
    104814575
   00500 Starch and sucrose metabolism
    104814575
   00520 Amino sugar and nucleotide sugar metabolism
    104814575
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    104814575
Enzymes [BR:thj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     104814575
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 499 aa AA seqDB search
MGKKVVVGAAIVGAAVVCAAAALMVRRRMRSSGKWARAMAILRAFEEDCATPIAKLRQVA
DALTVEMHAGLASEGGSKLKMLISYVDNLPTGDEKGLFYALDLGGTNFRVMRVLLGGKEG
RVVKQEFEEVSIPPHLMTGGSDELFDFIADALAKFVETEGEDFHPAPGRQRELGFTFSFP
VRQTSLVSGTLINWTKGFSIEDTVGQDVVGELNKAIERVGLDMRVAALVNDTVGTLAGGR
YYKPDVMAAVILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGNFRSSHLPLTEFD
HSLDFESLNPGEQIFEKIISGMYLGEILRRVLLKMAEEAAFFGDTVPPKLRIPFIIRTPH
MSAMHSDASPDLKVVGSKLKDILEIPTTSLKMRKVVISLCNIIASRGARLSAAGIYGILK
KLGRDVPKEGEQQKSVVAMDGGLFEHYSHFSASMESTLKELLGDEVSDNIEIIHSNDGSG
IGAALLAASHSQYLEVEDS
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagaaggtggttgtcggggcggctatcgttggagcggcggtggtctgcgctgcg
gcggcgctgatggttcgccggcggatgcggagctccggcaagtgggcccgagcgatggcg
atactgagggcgttcgaggaggattgcgcgactccgatcgcgaagctccgacaggtcgcc
gacgccttgacggtcgagatgcacgccggtctcgcctcggaaggtgggagcaagctcaag
atgctcatcagctacgtcgataatctccccactggggatgaaaaaggtctattttatgca
ctagaccttggcggaacaaacttccgtgtaatgcgtgtgctccttggtgggaaagaaggt
cgtgttgtcaaacaagaatttgaagaagtttccattcctcctcatcttatgacgggtggt
tcagatgaattattcgattttattgctgatgcactcgcaaagtttgttgaaacagaaggg
gaggatttccatcctgcaccgggtagacagagggagttaggtttcactttctcatttccg
gttaggcagacatctctggtgtctggtactctcatcaattggacaaagggcttctccatt
gaagatacagttggacaagatgttgtaggagaactcaataaagccatcgaaagagttggg
cttgacatgcgtgtcgccgcccttgtaaatgacactgttgggacactagccggtggcaga
tactataaaccagatgtcatggccgctgttatcttaggcactggtacgaatgctgcttat
gttgagcgtgcgcatgcaattcccaagtggcatggtctgcttcctaaatcaggggaaatg
gtcatcaacatggagtggggaaacttcagatcatcgcatcttccgttgacagagtttgac
cactccctggatttcgagagtctgaatccaggtgaacagatctttgagaaaataatttcg
ggtatgtacttgggagaaatcttgcgtagagttcttctgaagatggctgaagaggctgct
ttctttggtgacaccgtccctccaaagctgagaattccattcatcataaggacccctcat
atgtcggcaatgcactctgatgcttctccagacttgaaggttgtcggaagcaaactgaag
gacatattagagatccctacgacatctctcaaaatgagaaaagttgtaatcagtctctgc
aacatcatcgccagccgaggcgctcgtctatctgctgccgggatttatggcatcctcaag
aaactgggaagggatgtgcctaaagagggagaacagcagaaatcagtggtagccatggat
ggtgggctgtttgagcattactctcatttcagtgcttccatggaaagcacactaaaagag
ctacttggagatgaagtctcggacaatatcgagatcattcactcgaatgacgggtcgggc
attggagccgctctccttgcagcttctcattctcagtacctcgaagtggaggactcttaa

DBGET integrated database retrieval system