KEGG   Tarenaya hassleriana (spider flower): 104826660Help
Entry
104826660         CDS       T04125                                 

Definition
(RefSeq) thymidine kinase a-like
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
thj  Tarenaya hassleriana (spider flower)
Pathway
thj00240  Pyrimidine metabolism
thj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:thj00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    104826660
Enzymes [BR:thj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     104826660
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14
Motif
Other DBs
NCBI-GeneID: 104826660
NCBI-ProteinID: XP_010557775
LinkDB All DBs
Position
Unknown
AA seq 237 aa AA seqDB search
MASFKASLLLSSIDGECSGDGTFGQRRRGSGSVHVIMGPMFAGKSTALLRRIKSEISDGR
SVAMIKSSKDTRYAKDSVVTHDGIKFPCWALPDLMSFTEKFGDDAYSQLDVIGIDEAQFF
GDLYDFCCKVADEDGKTVIVAGLDGDYLRRSFGPVLDIIPIADTVTKLTARCELCGQKAF
FTLRKTCDTQTELIGGADVYMPVCRQHYINGQVVIKATKEVLDNDKAETESCVEMVV
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcattcaaagcttcgcttttgctcagttccatcgacggtgagtgttccggagat
ggtactttcggacagagacgtcgtgggtccggttcggttcatgttattatgggtcccatg
ttcgcagggaagtccacagctctgctccgccggatcaagtcggagatcagcgacggcaga
agcgttgcgatgataaaatcgagcaaggatacgaggtacgcgaaggattcggttgtgaca
cacgatgggatcaaattcccttgctgggccttgccagatcttatgtcttttactgagaag
tttggagatgatgcttattctcagcttgatgtgattggcatcgatgaggctcaattcttt
ggagatctttacgatttctgctgcaaggttgcggatgaagatgggaaaacagtgatagtg
gcaggcctagatggcgactatttgagaaggagctttggtcctgttctcgacattataccg
atagctgataccgtgacaaagttaactgcccgttgtgagctttgtggccagaaggctttc
ttcacactaagaaagacctgcgacactcagacggagctgatagggggagctgatgtctat
atgcctgtctgtcgccaacattacatcaatgggcaagttgtcatcaaagcaacaaaggaa
gttttggacaatgacaaagccgaaactgaatcctgcgttgagatggttgtgtag

DBGET integrated database retrieval system