KEGG   Tetragenococcus halophilus: TEH_23760Help
Entry
TEH_23760         CDS       T01640                                 

Gene name
ddl2
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
thl  Tetragenococcus halophilus
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:thl00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    TEH_23760 (ddl2)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TEH_23760 (ddl2)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    TEH_23760 (ddl2)
Enzymes [BR:thl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     TEH_23760 (ddl2)
Peptidoglycan biosynthesis and degradation proteins [BR:thl01011]
 Precursor biosynthesis
  Amino acid ligase
   TEH_23760 (ddl2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2365804..2366862
Genome map
AA seq 352 aa AA seqDB search
MDIVVLAGGLSYERDVSLSSGGKIATALEEKGHSVLLLDIYLGMDANNFEEALQKQTKNN
KNRDYSIGKKEPALENLTKFSQQQNDLVGNNVISICKSADFCFLALHGGIGENGKLQALF
DIYNIKYSGSDYKSSLLAMDKEVSKKLMDKEVSKKLMVSNHILTPNWEMIDSFYQRKISA
PCVVKPIDNGSSIGVEMVEEDTHLDEAVKAAEKFQSKIMIEEKITGREFSVGILGDSVLP
VIEIIPKHGFYNYENKYQEGATTEITPAEISEELTKKLSDLALLTHNTLGLSVYSRIDFM
VTSEFKIYCIEANSLPGMTPTSLLPQEAAAHGIHFSDLCEKIVQFSLDKYNV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgtggtacttgcaggcggtttgagttatgaaagagacgtgtctttatcttca
ggtggaaaaatagcaacagctttagaagaaaaaggtcatagcgttttactgttagatatt
tatttaggcatggatgcaaataatttcgaagaagccttacaaaagcaaacaaaaaataat
aaaaacagagactattctattggtaaaaaagaaccagctttagaaaatttaactaagttc
agtcaacaacaaaacgacttagttggaaataatgtcatttctatttgtaaaagtgctgat
ttttgctttttagcattacatggcggtattggcgaaaatggaaaactacaagcccttttt
gatatttataatattaagtattcaggcagtgattataagagtagtttattagcgatggat
aaagaagtttcaaaaaaattgatggataaagaagtttcaaaaaaattgatggtatcaaat
catatattaacgcctaattgggaaatgatcgattcattctatcaaagaaaaatttctgct
ccttgcgtagtaaagccgattgataatggttcaagtattggcgtagaaatggtagaagaa
gatactcatttagatgaagcagtaaaagcagctgaaaagtttcaaagtaaaataatgatt
gaagaaaaaattactggaagagagttttctgtaggtattttaggtgactctgttttacct
gtcattgaaatcatccctaaacacggtttttataactatgaaaataagtatcaagaaggt
gcaactaccgagattactcctgcagaaatttctgaggaattaacaaaaaaattgagcgat
ctagcccttttaacccataatactttaggattgtccgtttattctagaatcgattttatg
gtaacttctgaatttaagatctattgcattgaagccaacagtttacctggaatgacacct
actagtttacttccacaagaagctgcagctcatggtattcatttttctgatttatgtgag
aaaatcgtccaattttccttagataaatacaatgtataa

DBGET integrated database retrieval system