KEGG   Thermosynechococcus sp. NK55: NK55_03260Help
Entry
NK55_03260        CDS       T02977                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase dihydrolipoamide acetyltransferase E2 component PdhC
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
thn  Thermosynechococcus sp. NK55
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:thn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NK55_03260 (pdhC)
   00020 Citrate cycle (TCA cycle)
    NK55_03260 (pdhC)
   00620 Pyruvate metabolism
    NK55_03260 (pdhC)
Enzymes [BR:thn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NK55_03260 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
690744..691988
Genome map
AA seq 414 aa AA seqDB search
MIRELFMPALSSTMTEGKIVSWLKSPGDKVAKGETVLIVESDKADMDVESFYDGYLAVIT
VPAGEVAAVGSTIGLVAETEAEIAEAEAKAKSLGKATSSDRAPATSNGSGTAPAASAAAV
PAGRVIASPRARKLAKEHKIDLKTLKGTGPNGRITAADVEALIGAPAPPPVATSPAPLPT
APPATAPVVAKEDLVPLTTLQNAVVRNMVASLGIPDFHVAYTITTDALDRLYQQIKSKGV
TMTVLLAKAIALTLQKHPIMNAYYTEQGIQYRRDINIAVAVAMPGGGLITPVLKNADQID
IYSLSRTWKDLVERARAKQLQPDEYSTGTFSLSNLGMFGVDFFDAILTPGQGAIMAVGAS
RPTVVATEDGLLGVKRQMKVNITCDHRVIYGADAAAFLQDLAKLIETNPQALTL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgattcgtgaactgttcatgcccgccctcagctccaccatgaccgaagggaaaattgtc
tcttggctgaaatctcccggggataaggtggctaaaggggaaaccgtgctgattgtggaa
tccgacaaggccgatatggatgtggagtccttctacgacggctatttggcagtgattacc
gtacctgctggcgaagtagcagccgttggctccaccattggccttgtggcagaaacagaa
gcagaaattgcggaagcagaggcaaaggccaagtcccttgggaaggctaccagttctgac
cgggctccagccacgagtaatggctcaggaacggctcctgccgccagtgctgccgctgta
ccggctgggcgagtgattgcctccccccgtgcccgcaaattggccaaggaacacaaaatt
gatttgaagacgctcaagggaactggccccaatggtcggattacagccgccgatgtggaa
gctttgattggtgcgcctgcacccccccccgtggcaacgtcccctgcccctctccccacc
gccccccctgctactgctccggtggtggctaaggaggatttggtgcccctgacaacgctg
caaaatgccgttgtgcgcaatatggtggccagcctgggcattcccgatttccacgtcgcc
tacacgatcacaaccgatgccttggatcggctgtatcagcaaattaagtccaaaggggtg
acaatgacggtgctccttgccaaggcgatcgccctgacattgcaaaaacacccaattatg
aatgcctactacacagagcaggggattcaataccgtcgtgatattaacattgctgttgcg
gtggcgatgccggggggtggtctgattacaccggtgctaaagaacgccgatcaaattgac
atctacagcctctcgcgtacttggaaagacttggtggaacgggcacgcgccaagcaactg
caacccgatgagtacagcacgggcacctttagcctctcgaacctcggcatgtttggagtt
gacttctttgatgccattctcacgcccggtcaaggggcgattatggcggtgggggcgtcg
cgtccgacggtagttgccacagaggatggcctgctgggggtaaaacggcagatgaaggtg
aatattacctgtgatcaccgggtgatctatggtgctgatgcagctgccttccttcaggat
ttggcaaaactgattgaaactaatccccaagcattgacgctctaa

DBGET integrated database retrieval system