KEGG   Thiomonas intermedia: Tint_1837Help
Entry
Tint_1837         CDS       T01227                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tin  Thiomonas intermedia
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tin00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tint_1837
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Tint_1837
   00680 Methane metabolism
    Tint_1837
Enzymes [BR:tin01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Tint_1837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1969550..1972384
Genome map
AA seq 944 aa AA seqDB search
MPIQPLFAMSTRPSAARNASDPDAPLFDDIRLLGRLLGDLIREQEGQEMFDIVETVRQLS
VKFHRDGDAKDRRALDKLLSSLSRDQAVSVIRAFSYFSILANIAEDHHVLRRAEQDAERG
APPQRDSVRAALETLKDSGVDRQQLLQFFDQALISPVLTAHPTEVQRKSVLDAERALARL
LVERDATRLPQKRADIEDAMRARVVQLWQTRLLRYVKLKVSDEIKNALSFYGATFFSQFP
RLYRNLERDIEALFPAGGQDLAKTDLPAFFRMGHWIGGDRDGNPFVTADTLSYALRMQSR
TAIEFYMAEVHAIGGELSISALLASASPELMALAEQSPDLSEHRSDEPYRRALIGMYARL
AANLRKLAGVQALLPEVGSAEPYANADEFIADLRIIHDSLHRHHAGPLAQTRLDPLIRAA
GVFGFRLATIDLRQSSDQHEAVLRELLAAAGLCPDYSHQDEAAKQALLIRCLNDPRPLRL
PHHVYSDWARSELAVFDRAYSARRDFGPRAIRQYIISHSETVSDLLELLLLQKEAGLFHG
TLGSHDSYAELLVAPLFETIEDLRNAPAIMRDFYALPGIAGLVQRSGGEQEIMLGYSDSN
KDGGFFTSNWELYCAEVALAEQFEQLKAEHGITLRLFHGRGGTVGRGGGPSFDAILAQPP
GTVNGQIRLTEQGEVITSKYGNPEIGLRNLETLVAATLQATLLPQTKTASKPPARFLDAA
AALSEASMAAYRKLVYETPEFTDYFYSATPISEIAELNIGSRPSSRKATRAIADLRAIPW
GFSWGQCRVALPGWYGFGSGVQAFLDANPDGLKLLQRMAKQWPFFATLLSNIDMVLAKTD
LRVAQRYAELVADSKTRQKVLKALQREWQLTTDMLTAITGNTERLADNPTLKRSIRARFP
YIDPLNHLQIELLHRFREGQTDERTKRGIHLSINGIAAGLRNTG
NT seq 2835 nt NT seq  +upstreamnt  +downstreamnt
gtgcccattcaacccctcttcgccatgtcgacacgcccctcagccgcacgcaacgcctcc
gatcccgacgcacctctgttcgacgacatccgcctgctcgggcgtctgctgggcgacctg
atccgtgagcaggaggggcaggagatgttcgacatcgtcgaaaccgtgcgccagctctcc
gtcaagtttcaccgcgacggcgacgccaaagaccgccgcgccctcgacaaactgctcagc
agcctcagccgcgaccaggcggtcagcgtgatacgcgccttcagctacttttccattctg
gccaatatcgccgaagatcaccatgtgctgcgccgcgccgagcaggatgccgagcgtggc
gccccgccgcagcgcgacagcgtgcgcgccgccctggagacgctcaaggactccggcgtg
gatcggcaacaactcctgcagtttttcgaccaggcgctcatttccccggtgctcaccgcc
caccccaccgaggtgcagcgcaagagcgtgctcgacgccgaacgggcgctggcgcgactg
ctggtcgaacgcgacgcgacccgtctgccgcaaaagcgcgccgacatcgaagacgccatg
cgcgcccgcgtggtgcagctctggcagacgcggctgctgcgctacgtcaagctgaaagtg
tcggatgaaatcaagaacgcgctgtcgttttatggcgccacgtttttttcgcaattcccg
cgcctgtatcgcaacctggagcgcgacatcgaggcgctctttcccgcaggcgggcaagac
cttgcaaagaccgatctgccggcctttttccgcatgggccactggatcggcggcgaccgc
gacggcaaccccttcgtcaccgccgacaccctgagctacgccttgcgcatgcagtcgcgc
accgccatcgagttctacatggccgaagtgcacgccatcggcggcgagctgtcgatctcg
gcgctgctggccagcgccagcccggaactgatggccctggccgaacagtcgcccgatctg
tcggaacaccgcagcgacgagccctaccggcgtgcgctcatcggcatgtacgcgcgccta
gccgccaacctgcgcaagctcgccggggtgcaggccctgctgcccgaagtgggcagcgcc
gagccttatgccaatgccgacgagttcatcgccgatctgcgcatcatccacgactcgctg
caccggcatcatgccgggccgctggcacagacgcggctcgacccgctgatccgcgccgcc
ggggtgttcggcttccgcctggccaccatcgacctgcggcaaagctcggatcagcacgaa
gccgtgctgcgcgaactgctcgccgccgccggtctgtgccccgactacagccatcaggat
gaagccgccaagcaggcgctgctcatccgctgcctcaacgacccgcgtccgctgcgtctg
ccgcaccacgtctattccgactgggcgcgcagcgaactggccgtgttcgaccgcgcctac
agcgcccggcgagacttcggcccgcgcgccatccggcaatacatcatctcgcactccgag
accgtcagcgatctgcttgaactgctgttgctgcaaaaggaagccgggctgttccacggc
acgctgggcagccacgacagctacgccgagctgctggtggcgccgctgttcgaaaccatc
gaagacctgcgcaacgccccggccatcatgcgcgacttctatgccctgcccggcatcgca
gggctggtgcagcgctccggcggcgagcaggagatcatgctgggctattccgacagcaac
aaggacggcggcttcttcacctccaactgggagctgtattgcgccgaggtcgcgctagcc
gagcagttcgaacagctcaaggccgagcatggcatcaccctgcggctgttccacggccgt
ggcggcacggtgggacgcggcggcgggccgagcttcgacgccatcctcgcccagccgccg
ggcacggtgaatggccagatccgtctgaccgaacagggcgaggtcatcaccagcaaatac
ggcaatcccgagatcgggctgcgcaacctcgaaaccctggtggccgccacgctgcaggcc
acgctgctgccgcagaccaagaccgcgagcaagcccccggcgcgcttccttgacgcggct
gccgccctgtccgaagcctccatggcggcctaccgcaagctggtgtacgagaccccggaa
ttcaccgattacttttacagcgccacccccatttccgagatcgccgagctcaatatcggc
agccgcccctcctcgcgcaaggccacccgcgctattgccgacctgcgcgccattccctgg
ggtttctcgtggggccagtgccgcgtggcgctgcccggctggtatggcttcggcagcggg
gtgcaggccttcctcgacgccaaccccgacggcctcaaactcctgcagcgcatggccaag
cagtggcccttcttcgccaccctgctgtcgaacatcgacatggtgctggccaagaccgat
ctgcgcgtggcgcagcgttatgccgaactggtggccgactccaagacgcgccagaaggtg
ctcaaggcgctgcagcgcgaatggcagctcaccaccgatatgctcaccgccatcaccggc
aacaccgagcgcctggccgacaaccccacgctcaagcgttcgatccgcgcccgctttccg
tatatcgacccgctcaaccacctgcagatcgaactcctgcaccgtttccgcgaagggcag
accgacgagcgcaccaagcgcggcattcacctgagcatcaacggcatcgccgcggggctg
cgcaataccggctga

DBGET integrated database retrieval system