KEGG   Thermoanaerobacter italicus: Thit_1856Help
Entry
Thit_1856         CDS       T01178                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
tit  Thermoanaerobacter italicus
Pathway
tit00473  D-Alanine metabolism
tit01100  Metabolic pathways
tit01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tit00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Thit_1856
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Thit_1856
Enzymes [BR:tit01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Thit_1856
Peptidoglycan biosynthesis and degradation proteins [BR:tit01011]
 Precursor biosynthesis
  Racemase
   Thit_1856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Radical_SAM
Motif
Other DBs
NCBI-ProteinID: ADD03098
JGI: Thit_1856
UniProt: D3T4E6
LinkDB All DBs
Position
complement(1902761..1903918)
Genome map
AA seq 385 aa AA seqDB search
MFDNIRPTRAEIYLDNIVHNLSEVKRWVGKKVKIMGVVKANAYGHGACHVAKVLVENGVC
YLGVATIEEALELRECGINIPILVFGYTPLTQAEELIVHNITQTVFDINYVEDLEKIALK
VGKKAKVHVKIDTGMGRIGYTDLKVAEKEIEKMMEMEGVEVEGIFSHFATSDEKDKSYAE
QQFDMFKKLLERLKEKGINIPLKHMANSGAIIDLKYTYLDMVRPGIVLYGSYPSEEVKRP
LDLKQTMGFKTKIVYIKEVPEGTSISYGKTFITKRKSKIATLPVGYADGFNRLLSNNYHV
LVKGKYAAVVGRICMDQTMIDVTDIEGVEVGDDVIIFGNQEGEKITAEEIAKKLNTIPYE
VYCGISSRVPRIYIYKGKVVGEKII
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgtttgataatataaggccaacaagagcagaaatatatttggataatatagtgcataat
ttgagtgaagtaaaaagatgggtgggcaagaaagtaaaaataatgggtgtagtgaaagcc
aatgcttatggtcatggcgcttgtcacgtagcaaaagttttggtagaaaatggggtttgc
tatttgggggtagcgacaatagaagaggcgttagaattaagggaatgcggaattaatatt
cccatactcgtttttggatatactcctttaactcaggccgaagaattaattgtgcacaat
ataactcaaactgtttttgatataaactatgttgaagacttagaaaaaattgctttaaag
gtgggtaaaaaagctaaagtacatgtaaaaattgatacaggcatgggacggataggatat
acggatttaaaggtagcagaaaaagaaatagaaaaaatgatggaaatggaaggggtagag
gtagaaggtatatttagtcattttgctacttctgatgaaaaagataagagctatgctgaa
caacagtttgatatgttcaagaaattattagaaaggttaaaagaaaaagggataaacatt
cctttaaaacatatggctaacagtggagcaattattgaccttaaatatacttatttagat
atggtgagaccaggaatagttctatacggtagttatccttcagaagaagtcaaaagacca
ttggatttaaaacagactatgggttttaaaactaaaatagtatatataaaagaagtgccc
gaaggcacttccataagttatggaaagacatttataactaaaagaaagagtaaaattgct
acattgcctgtagggtatgctgacggttttaatagattactttctaataattatcatgtg
ctagtgaaagggaaatatgctgctgtggttggaaggatttgtatggaccaaacgatgata
gatgttaccgatatagaaggagtagaagtaggtgatgatgtaattatttttggaaatcaa
gagggagaaaaaataacagctgaggagattgctaaaaaattaaatactataccttatgaa
gtatattgtggaatatccagcagggtacctcgaatatatatttacaagggaaaggtagtt
ggggaaaaaattatttaa

DBGET integrated database retrieval system