KEGG   Thermococcus kodakarensis: TK1884Help
Entry
TK1884            CDS       T00226                                 

Definition
(GenBank) alpha-amylase precursor, GH13 family
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
tko  Thermococcus kodakarensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tko00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TK1884
Enzymes [BR:tko01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     TK1884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1693718..1695103
Genome map
AA seq 461 aa AA seqDB search
MKKFVALLITMFFVVSMAAVAQPASAAKYSELEEGGVIMQAFYWDVPAGGIWWDTIRSKI
PEWYEAGISAIWIPPASKGMGGAYSMGYDPYDFFDLGEYNQKGTVETRFGSKQELINMIN
TAHAYGIKVIADIVINHRAGGDLEWNPFVGDYTWTDFSKVASGKYTANYLDFHPNEVKCC
DEGTFGGFPDIAHEKEWDQHWLWASDESYAAYLRSIGVDAWRFDYVKGYGAWVVKDWLNW
WGGWAVGEYWDTNVDALLNWAYSSGAKVFDFPLYYKMDEAFDNTNIPALVDALQNGGTVV
SRDPFKAVTFVANHDTDIIWNKYPAYAFILTYEGQPVIFYRDYEEWLNKDKLNNLIWIHD
HLAGGSTSIVYYDSDELIFVRNGDSKRPGLITYINLGSSKVGRWVYVPKFAGACIHEYTG
NLGGWVDKYVESSGWVYLEAPAYDPASGQYGYTVWSYCGVG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagtttgtcgccctgctcataaccatgtttttcgtagtgagcatggctgccgtt
gcacagccagctagcgccgcaaagtattccgaactcgaagaaggcggcgttataatgcag
gccttctactgggacgttccagcgggaggaatctggtgggatacaatcagaagcaagata
ccggagtggtacgaggctggaatctccgccatctggattccgccagccagcaagggcatg
ggaggagcttattcaatgggctacgacccatacgacttcttcgacctcggcgagtacaac
cagaagggaacagttgaaactcgctttggctcaaagcaggagcttatcaacatgataaac
accgcccatgcctacggcataaaggtcatagctgatatcgtcataaaccaccgcgcgggc
ggagacctcgagtggaacccgttcgttggggactacacctggacggacttctcgaaggtg
gcctcgggcaaatataccgccaactacctcgacttccaccccaacgaggtcaagtgctgt
gacgagggcacatttggaggtttcccagacatagcccacgagaaggagtgggaccagcac
tggctctgggcgagcgacgagagctacgccgcctacctcaggagcatcggcgttgatgcc
tggcgtttcgactacgtaaagggctacggagcgtgggtcgtcaaggactggctcaactgg
tggggcggctgggccgtcggtgagtactgggacacgaacgttgatgcactcctcaattgg
gcatactcgagcggcgccaaggtcttcgacttcccgctctactacaaaatggacgaggcc
tttgacaacaccaacatcccggccttggttgatgccctccagaacgggggaaccgtcgtc
tctcgcgacccgttcaaggccgtaacctttgtagcaaaccacgacaccgatataatctgg
aacaagtaccctgcttatgctttcatcctcacctacgagggccagcccgtcatattctac
cgcgactacgaggagtggctcaacaaggacaagcttaacaacctaatctggatacacgac
cacctcgcgggtggaagcacgagcatagtctactacgacagcgacgagctgatcttcgtg
aggaacggcgactccaagaggccgggactgataacgtacatcaacctcggctctagcaag
gtcggaaggtgggtgtacgtgccgaagttcgcgggcgcgtgcatccacgagtacaccggc
aacctcggaggctgggtagacaagtacgtcgagtcgagcggctgggtctatctcgaagct
ccagcttacgaccccgccagcgggcagtacggctacaccgtctggagctactgcggggtt
ggatga

DBGET integrated database retrieval system