KEGG   Thermococcus litoralis: OCC_02099Help
Entry
OCC_02099         CDS       T02800                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tlt  Thermococcus litoralis
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tlt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    OCC_02099
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    OCC_02099
   00680 Methane metabolism
    OCC_02099
Enzymes [BR:tlt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     OCC_02099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1973572..1975002)
Genome map
AA seq 476 aa AA seqDB search
MIPRTMSTQHPDNVFIPFFAHDAALGGEDEVVEAFYAFSVLGVDEQMWDFEGKEVDEFVV
KKLLEKYGSFFRKRKLGKDFRITPRVPNPSVERAEAKLLLETLESIPRSADYAKLFYGEE
IAPIFEVILPMTTSSEEIERVYELYRRYIIGKQYKRVYDVKIYEWIGEFYPEEINIIPLF
ETKEAILNSHEILEEYLTGKNFEYQRVFLARSDPAMNYGLISAVMYDKYALFKLQELEEE
LSIPIYPIIGVGGVPFRGHFTPKNVDAAMEEYPSVQTFTVQSSFKYDNEPKEVIKAIEKV
NDTKRKETPAIDERIFEILDKYEEEYTKELKILAPYIREVAKAVPSRRKRKLHIGLFGYS
REVNGEALPRAIKFTASLYSLGIPPEILGLRALSEKELETISEHYRGLYNDISFALRFFN
PKAASHFKFLEDIAKMQKEMGIEKDERHLSITTQILNGKIEESLVVEAAGIRGFLG
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgataccaagaactatgagtactcaacatcccgacaatgtatttatacctttttttgct
catgacgctgcccttggaggagaggatgaagtggttgaagcgttctatgctttcagcgtt
cttggagtagacgagcagatgtgggatttcgaaggaaaggaggttgacgaattcgttgta
aagaaattactggaaaaatatggaagctttttcagaaaaagaaagcttggcaaggacttt
aggatcacaccccgtgtgccaaatccaagtgtggagagagcagaggcaaagcttttgctt
gaaacgcttgaaagtattcccagatccgccgactatgcaaagttattttacggagaggaa
atcgctccaatttttgaagttatattacccatgacaacttcttctgaagaaatcgaaagg
gtgtacgagctttacagaaggtatatcataggaaagcagtacaaaagggtgtacgacgtt
aaaatctacgagtggattggagaattttatccagaagagataaacataattcccttattc
gagacaaaagaggccattctgaactcccacgaaatcctggaggaatatctgaccggaaaa
aactttgagtaccagagggtatttttggccagaagcgaccctgcaatgaactatggtctc
ataagtgcggtaatgtatgacaaatatgctttattcaaactccaagaacttgaagaagaa
ctaagcatccccatatatccaataattggtgtcggtggagtcccttttaggggacatttc
acacccaagaatgttgatgcagcaatggaagaataccccagcgtccagacctttactgtc
caaagttcatttaaatatgataatgagcctaaagaagttatcaaagctattgaaaaggta
aacgatacaaaaagaaaagaaacgccagcaattgatgagaggatatttgagatactcgac
aaatatgaagaagaatacaccaaggaacttaagattctcgccccatatatacgagaggtt
gcaaaggctgttccctcaagaaggaaaaggaagcttcacatagggctctttgggtattca
agagaggtcaatggagaagcccttccgagggctataaagttcacggcatctctgtactct
ctcggaatacctccagaaatcctaggattaagagcgctaagtgaaaaggagctggagaca
ataagtgaacactacagggggctttataatgatatatcttttgcgttaagattttttaat
ccaaaagcggcttcccatttcaaatttttggaggatatagctaaaatgcaaaaagaaatg
ggcatagaaaaggatgaaaggcatctaagcataaccactcagatactgaatggaaaaatt
gaagagagccttgtggtagaggcggctggtatcagaggatttctcggctaa

DBGET integrated database retrieval system