KEGG   Tuber melanosporum: GSTUM_00000322001Help
Entry
GSTUM_00000322001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K11987  
prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
tml  Tuber melanosporum
Pathway
Arachidonic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tml00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    GSTUM_00000322001
Enzymes [BR:tml01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     GSTUM_00000322001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
INRA: 
UniProt: 
LinkDB All DBs
AA seq 1119 aa AA seqDB search
MASNGDGTNGATNGDSKYATQSKPPPPVAKPTRAAVDSTFEQFSNLLHASNRPLPNRFGD
GKDQRPPELKPTGVLTDINTLRRGGFFWESVGTLWDFLKQKAKGGAVDDKTMIMERVIQL
TSRLPPTSKARVALTTLQVDQLWDSLQHPPLSYLGDEFSYRQADGGYNNIMYPQLGRAGS
AYARSVKPMTKMPGAPPDAYTLFDRIFSRGPNDEHFREHDNNVSSMLFYTATIIIHDLFR
TNRENQNISDTSSYLDLAPLYGSSVEDQSKIRTFQDGKIKPDSYSEKRLLAFPPGVSVLL
IMFGRFHNYVVENLKAINEGGRFNLKFPRYPNGDDEVTRQAKALRQQDEDLFQTGRLVTC
GLYINFILNDYLRTIVNLNRVDTTWTLDPRFEASKVYNPDGTPAGIGNMVSAEFNLIYRW
HSCISKRDDQWTKDFYQGLFPGRDASDIEMPEFTRGVGRWERSLSDDPIQRNIAGLERKA
DGSYHDDDLVKILTESVEDVAGAFGARNVPHVLRLVEVLGIEQSRKWMVGSLNELREFFG
LKPHATFEDINPDPAVANTLRQLYDHPDFVEMYAGLVAEADKKPMVPGVGIGPTYTISRA
ILSDAVTLVRGDRFYTADYTASHLTNWGLQEASSDLATVYGCVGYKLILKAFPNHFKFNS
IYAHYPLTIPQENHKIHTALNSVDQFDFERPVYTPPRIPISSYNATKQILCDAENFKVTW
GAGFDFIMRADFMLSGDKPSNSEQKQFVRDRLYLGGVDWKQQIRQFYEEATEKLIRKKAY
SLGDTYQVDAVRDIGNIAQTIFAASIFNLPMKSEDHPKGIYTEQELYMILCVMFIVIFFD
IDSSKSFPLRQAGFKVVRQYGTLVEAQVKAIKNWSWLQGVWDPLNIRGRNKSSPLKSYGW
TMIKRLLDTGKSPYDVTWSYIVPTAGASAPNQGQIFAQVLDFYLEDRNSHHLAEIQRLAQ
SGAVDAWETIKKYALEGGRLAGTFGLYRRVEPDNITIEDNGRNIELRKGDMVFVNFITAS
RDPVVFPDPLEIKLDRPEASYMQYGDGPHECLGKAANIIGLTTMLMQFGKLKGLRRAPGP
QGALKYIPKPGGFKVYMKEDWSAYWPFPTSMKVRFDDII
NT seq 3360 nt NT seq  +upstreamnt  +downstreamnt
atggcctctaatggtgatggcaccaatggtgccacgaacggtgatagcaaatacgctaca
cagtcaaagccccctccgcccgtcgcaaaacctacgagagcggcagtggatagtaccttt
gaacaattctcaaacttattacatgcttctaaccgccccctaccaaacagattcggggac
ggaaaggatcagaggcccccagagcttaaaccaactggagtattgaccgacattaacaca
ttgagacgtggggggttcttttgggagagtgtgggaacgctatgggatttcctcaagcag
aaggcaaagggtggagcggtagacgacaagactatgattatggaacgtgtcatacaactt
acttcacgactcccgccaacaagcaaagctcgcgttgccttgaccacactccaggtagat
caactttgggactcgctccaacaccctccgttatcttatctcggtgatgagttctcttat
cgccaggcagatggtggatacaacaacataatgtaccctcaactgggtcgtgcgggctcc
gcatatgcgagatctgtgaagccaatgacaaagatgcccggagcaccaccagatgcatac
acgcttttcgacaggatcttctctcgaggacctaacgatgagcacttccgtgaacacgat
aacaacgtcagtagtatgttgttttataccgcgactattattattcatgacttgttccga
accaaccgggagaatcaaaatatctcggatacatcatcatacctggacctggcgccgctc
tatggaagcagtgtagaggaccagtccaagatcaggacattccaggacggaaagatcaag
ccggacagttacagtgaaaagaggttgctggctttccccccgggtgtttcggtattgctc
atcatgtttgggcggttccataactacgttgttgagaatctcaaggccattaatgagggt
ggacgatttaacctaaagttccccagataccctaatggggatgatgaggttaccaggcag
gcaaaggccctgaggcagcaggacgaagacttgttccagactggtagattggtcacctgt
ggtctatacatcaactttatcctcaacgactacctgaggactattgtcaacttgaaccga
gtagacaccacctggacacttgatccgcgatttgaggctagcaaggtttacaatcccgat
ggaactcctgctggtattggtaacatggtctctgccgagttcaacttgatctacagatgg
cactcttgcatttccaagcgtgacgatcaatggacaaaggatttctaccagggtctgttc
cccgggagggatgccagtgacattgaaatgcccgagttcactagaggtgtcggtaggtgg
gagaggagcctcagcgacgaccccatccagcggaacatcgccggtttagagcgcaaagcc
gacggcagttatcatgacgacgacctagtgaagatcctcacagagagcgtcgaagatgtt
gcaggtgcctttggtgcgcgcaatgttccccatgtcctccgccttgttgaggtattgggt
attgagcaatcccgcaagtggatggtcggctccttgaacgaactccgcgagttcttcgga
cttaaaccacacgcaaccttcgaggatatcaatcccgacccggccgtggccaacacactc
aggcagctttacgatcacccggacttcgttgagatgtatgctggtctcgtggccgaagcc
gacaagaagccgatggttccgggtgtcggtatcggacccacatacaccatctcccgtgcc
attctcagtgacgctgttactctagttcgcggtgacaggttctacactgccgattacact
gcctcccacttgaccaactggggtcttcaggaggcatcttctgatctggctaccgtctat
ggatgcgtgggatataagctgattctcaaggctttcccgaaccacttcaagttcaactcc
atctacgcacactacccactcaccatcccgcaagagaaccacaagatccacactgctcta
aactcggttgatcaattcgatttcgagagaccggtctacactcctccccgcattcccatc
tcatcctacaacgccacgaaacagattctgtgcgatgctgaaaacttcaaggtcacctgg
ggtgctgggttcgactttatcatgagggcggatttcatgttgagcggtgataagccgtcc
aattccgaacagaaacagtttgtccgcgaccggttgtaccttgggggtgtagattggaag
caacagattaggcaattctacgaggaggctacggagaagttgatccggaagaaggcatac
agcctcggtgatacttaccaagtcgatgcagttagagacatcggaaatatcgcccagaca
atctttgcagcgtcaatctttaatctaccgatgaagagcgaggatcacccaaagggaatc
tacacggaacaagagctctacatgatcctgtgcgtcatgttcatagtcatcttctttgac
attgactccagcaagtcattcccgctacgccaggcgggattcaaggtagtccgccaatac
ggcactctcgtggaagcccaggtcaaagccatcaagaactggtcatggctccaaggggtc
tgggatccactcaatattcgcgggcgcaacaagtcctccccgctcaaatcttatggctgg
acgatgatcaagcgtctcctcgacaccggaaaatctccatacgacgtgacctggtcgtac
attgttcccacagcaggggcatcggcaccaaaccagggccagatattcgcccaggtcctg
gacttctacctagaagacaggaattctcatcacctcgccgagatccaacgactggcgcaa
tcgggcgcggtggacgcctgggaaactatcaagaagtatgctctcgaaggcggccgtctc
gccggcacttttggcctctaccgccgcgtcgagccggataacatcacgatcgaagacaac
ggacgcaacatcgaactccgaaagggcgacatggtattcgtaaatttcatcaccgcctcc
cgcgatcccgtggtcttccccgacccgctcgaaatcaaacttgaccgacctgaggctagt
tacatgcaatacggcgacggcccgcacgaatgccttggaaaggcggcgaatatcattggc
ctcactaccatgcttatgcaatttggtaagctcaaggggttgaggagagcgcccggacca
caaggagcgctcaagtatattcctaagccgggtggcttcaaggtttacatgaaggaggac
tggagcgcatactggcccttcccgacgagtatgaaggttaggtttgacgatattatttag

DBGET integrated database retrieval system