KEGG   Tuber melanosporum: GSTUM_00010406001Help
Entry
GSTUM_00010406001 CDS       T01282                                 

Definition
(RefSeq) hypothetical protein
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
tml  Tuber melanosporum
Brite
Enzymes [BR:tml01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     GSTUM_00010406001
Chromosome [BR:tml03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     GSTUM_00010406001
   HDAC complexes
    Sin3A-HDAC complex
     GSTUM_00010406001
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    GSTUM_00010406001
  Chromatin remodeling factors
   NuRD complex
    GSTUM_00010406001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
INRA: 
UniProt: 
LinkDB All DBs
AA seq 642 aa AA seqDB search
MKPHRIRMTHSLIMNYRLYKKMEIYRAKPATKQEMCQFHTDEYIDFLSKVTPDNMEQYSK
EQGKYNVGDDCPVFDGLFEFCGISGGGSMEGAARLNRGKCDIAINWAGGLHHAKKSEASG
FCYVNDIVLGIIELLRYKQRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTG
ELRDIGVGAGKYYAVNFPLRDGITDTTYKEVFEPVIGHVMEFYQPDAVVLQCGADSLSGD
RLGCFNLSMAGHANCVEYVKKFNLPTLVVGGGGYTMRNVSRAWTYETGILVNQKVGPNLP
FSDFYEYFGPDYELDVRPSNMENLNSKEYLEKIKIQVLSNLERTRHAPSVQTTDVGKGLT
EHQEEQDAILDDIDEDGPGMDARQTQRQWDRATEKEGELYSDSEDEEITSSMGVRKTSKK
GLRNVRDWKEGGSGTGSGNATPFTGPGGSDNASESAGGNTAKGSGATSKRDGEGRDLTEF
DEELEALRKETEEEVQPDNDGDVEMGDDEQPPPSADALTDEVADEEMTDVPAQSSTSSTK
VDPIPTAESLSQAKPEAATTDDKIRVEASEFSKAETPAKGSGSGVPKPSESSVANAAPEG
SNSMASTTDRHSSKPPLVADESVSSTAKAPANPVEAPAKEEK
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgcacagaatccggatgacccatagtttaatcatgaactaccggctttacaag
aaaatggaaatttatcgagcaaaaccagccactaaacaagaaatgtgtcaattccacacg
gacgaatacatcgattttctgtcgaaggtgacgcctgacaacatggaacaatattccaaa
gagcaaggaaaatacaatgtcggcgacgattgcccagtattcgacggtttgtttgagttt
tgcggcatatccgggggtggcagtatggaaggtgccgccagactcaaccgtggaaaatgc
gatattgcgattaattgggccggcggccttcatcacgcgaaaaagagtgaagcttctggg
ttctgctatgttaatgacattgtcctcggaattattgaactactccggtacaaacagcgt
gttctttacattgatatcgacgttcaccacggtgatggcgtggaagaagctttttatacc
actgatcgcgttatgactgtatccttccacaagtacggtgaatactttccaggtaccggt
gaacttcgtgacattggtgttggcgctggaaagtactatgcagtaaacttcccattacgc
gatggtattaccgataccacatataaggaggttttcgaaccagtcattgggcacgtgatg
gagttctatcagcctgatgctgtggttctgcagtgtggtgcggacagcttgtcaggtgat
agactggggtgcttcaatctaagcatggcgggtcatgcaaattgcgttgaatatgtcaag
aaattcaaccttccaactcttgtggtcggcggtggtggctatacaatgagaaatgtcagt
agagcttggacatatgaaaccggcatccttgtcaaccagaaggttgggccaaacttgccc
tttagtgacttttacgagtactttggccccgattacgagcttgatgtccgcccatcaaac
atggaaaacctcaattcaaaggagtacttggaaaaaataaaaatacaggtcctgtccaat
ctcgaacgtactcgacatgcccccagtgtccagactacagacgttgggaaaggtttgaca
gagcatcaggaggagcaagatgcaattttagacgatattgatgaggacggcccgggcatg
gatgcccgtcaaactcagaggcagtgggatcgcgcaacagagaaggagggagagctgtac
agtgacagtgaggatgaagagatcacaagttcaatgggagttcggaaaactagcaaaaaa
gggctgcgcaatgttcgggattggaaagagggtggttccgggacaggatccggaaatgca
actcccttcacaggacctggcggaagcgataatgcaagtgaatccgccggtggtaacaca
gctaaaggcagtggagccacaagcaaacgagatggagaaggtcgtgacctcaccgagttc
gacgaggaactcgaggcattgagaaaagagacagaagaagaggttcaacccgacaacgac
ggagacgtagagatgggagatgatgagcagccaccgccaagtgccgatgctctaacagat
gaagtagcggatgaagaaatgaccgatgttcccgcacaatcttcaacatcctcaacaaaa
gtagaccctatccccacggcggaatccttatcccaagccaagcccgaggccgcaaccact
gacgacaagatcagagtcgaggctagcgaattttccaaagcagaaactcctgcgaagggt
tccggttccggagtacctaagccctccgagtcttctgttgcaaatgcagctcccgaggga
tctaattctatggcgtctaccactgacagacatagctcaaaacctcctctcgtggcagac
gagtctgtatcaagtaccgctaaggctcctgccaacccggttgaggctcccgccaaagaa
gagaaataa

DBGET integrated database retrieval system