KEGG   Tistrella mobilis: TMO_1550Help
Entry
TMO_1550          CDS       T02128                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
tmo  Tistrella mobilis
Brite
Enzymes [BR:tmo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     TMO_1550 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1718524..1719123)
Genome map
AA seq 199 aa AA seqDB search
MAFELPALPYDKTALEPHISAQTFEFHHGKHHNTYVVNLNKLVEGTDLADASLEDIIVKS
RGDAAKAGVFNNAAQVWNHTFFWNSMKPNGGGAPSGDLAKRIDADFGGLDKFKEAFKNAA
TTQFGSGWAWLVVKDGKLEVVKTGNAETPVGTGATPLLTIDVWEHAYYLDYQNRRPDFVQ
SFLDNLVNWDFAAENLAKA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcgaacttcccgccctgccctacgacaagaccgctctggagccgcacatctcg
gcccagaccttcgagttccatcacggcaagcaccacaacacctatgtcgtgaacctcaac
aagctggtcgagggcaccgatctcgccgacgccagcctcgaggacatcatcgtcaagagc
cgcggcgatgcggcgaaggccggcgtgttcaacaacgccgcgcaggtgtggaaccacacc
ttcttctggaattcgatgaagccgaatggcggcggcgccccctcgggcgaccttgccaag
cgcatcgatgccgatttcggtggcctcgacaagttcaaggaggcgttcaagaacgccgcc
accacccagttcggctcgggctgggcctggctggtggtgaaggacggcaagctcgaggtc
gtgaagaccggcaatgccgagaccccggtcggcaccggcgccacgccgctgctcaccatc
gacgtctgggagcatgcctactacctcgactatcagaaccgtcgcccggatttcgtccag
tccttcctggacaatctggtgaactgggacttcgcagccgagaacctcgccaaggcctga

DBGET integrated database retrieval system