KEGG   Tistrella mobilis: TMO_a0392Help
Entry
TMO_a0392         CDS       T02128                                 

Definition
(GenBank) glutathione S-transferase protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
tmo  Tistrella mobilis
Pathway
tmo00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    TMO_a0392
Enzymes [BR:tmo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     TMO_a0392
Transporters [BR:tmo02000]
 Other Transporters
  Pores ion channels [TC:1]
   TMO_a0392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: AFK55795
UniProt: I3TSQ7
LinkDB All DBs
Position
pTM1:440001..440609
Genome map
AA seq 202 aa AA seqDB search
MSDELILYTNPQSRGMIARWMLEEVGVPYRMVVLEYGAPMKAPDYLALNPMGKVPTLVHN
GAVVTECAAICAYLAETFPEAGLAPRPHERAAWFRWLFFGAGPLEAAVSNRALGIEVPAE
RERSIGYGSFTRVMDTLEVAVSASPYLAGDRFTAADVYLGAQIGWGLQFGTIDRRPAFET
YWARLAGRPALTRASATDDMAG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgagctgatcctttacaccaacccgcaatcgcgcggcatgatcgcgcgctgg
atgctggaagaggtgggcgtgccctatcgcatggtggtgctggagtatggcgcgccgatg
aaggcgcccgattatctggcgctcaaccccatgggcaaggtgccgaccctggtccataac
ggcgcggtggtgaccgaatgcgccgcgatctgcgcctatctggccgaaaccttccccgaa
gcggggctcgccccccgtccccatgaacgcgcggcctggttccgctggctgttcttcggc
gcggggccgctggaggcggcggtcagcaaccgcgcactcggcatcgaggtgccggcggaa
cgcgagcgcagcatcggctatggcagtttcacccgggtgatggacacgctggaggtggcc
gtttccgccagcccctaccttgccggcgaccgcttcaccgcggcggatgtgtatctcggc
gcccagatcggctggggcctgcaattcggcaccatcgaccgacgcccggcctttgaaacc
tactgggcccgcctggccggccggccggcgttgacgcgggcctcggcgaccgacgacatg
gcggggtag

DBGET integrated database retrieval system