KEGG   Thauera sp. MZ1T: Tmz1t_3219Help
Entry
Tmz1t_3219        CDS       T00804                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
tmz  Thauera sp. MZ1T
Brite
Enzymes [BR:tmz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Tmz1t_3219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACR01814
JGI: Tmz1t_3219
UniProt: C4KBT3
LinkDB All DBs
Position
3520498..3521082
Genome map
AA seq 194 aa AA seqDB search
MEHTLPALPYAKDALAPHISAETLEFHYGKHHQAYVTNLNNLIKGTEYENLDLEAIVKKA
PAGGVYNNSAQVWNHTFFWNSMKPNGGGEPSGALADAIKAKWGSFDDFKKAFQASAVGNF
GSAWTWLVKKADGSVDIVNMGAAGTPLTTGDKALLCIDVWEHAYYIDYRNRRPDFVATFL
DKLANWDFAAKNFA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggaacacaccctgcccgccctgccctatgccaaggacgccctcgccccgcacatctcg
gccgagaccctggagttccactacggcaagcaccaccaggcctacgtcaccaacctgaac
aacctgatcaagggcaccgagtacgagaacctcgacctcgaagccatcgtcaagaaggcc
cccgccggcggcgtgtataacaactccgcgcaggtgtggaaccacaccttcttctggaac
agcatgaagcccaacggcggcggcgagcccagcggcgcgctggccgacgcgatcaaggcc
aagtggggctccttcgacgacttcaagaaggccttccaggcctccgcagtcggcaacttc
ggttccgcctggacctggctggtcaagaaggccgacggctcggtcgacatcgtcaacatg
ggcgccgccggcacccccctgaccaccggcgacaaggccctgctctgtatcgacgtgtgg
gaacacgcctactacatcgattaccgcaaccgtcgtccggacttcgtcgccaccttcctc
gacaagctggccaactgggacttcgcggcgaagaacttcgcctga

DBGET integrated database retrieval system