KEGG   Pyrobaculum neutrophilum: Tneu_0068Help
Entry
Tneu_0068         CDS       T00682                                 

Definition
(GenBank) DNA ligase I, ATP-dependent Dnl1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
tne  Pyrobaculum neutrophilum
Pathway
tne03030  DNA replication
tne03410  Base excision repair
tne03420  Nucleotide excision repair
tne03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:tne00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Tneu_0068
   03410 Base excision repair
    Tneu_0068
   03420 Nucleotide excision repair
    Tneu_0068
   03430 Mismatch repair
    Tneu_0068
Enzymes [BR:tne01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Tneu_0068
    6.5.1.6  DNA ligase (ATP or NAD+)
     Tneu_0068
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Tneu_0068
DNA replication proteins [BR:tne03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Tneu_0068
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Tneu_0068
DNA repair and recombination proteins [BR:tne03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Tneu_0068
   NER (nucleotide excision repair)
    Other NER factors
     Tneu_0068
   MMR (mismatch exicision repair)
    Other MMR factors
     Tneu_0068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase Bac_luciferase DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: ACB39026
JGI: Tneu0068
UniProt: B1YA52
LinkDB All DBs
Position
63169..64923
Genome map
AA seq 584 aa AA seqDB search
MQFGELVKTLAAVESTTQRTTMVKLLTSLLKRARPDEVDKIVYFVLGDLKPPWEGVELGV
AEKLCLRAVSKAAGTPLSELEAVYKRTGDVGEAARRALSAAKRPGLLAFGQQKPLEVSEV
YDTLLKVAKAAGEGAQDMKISLLASLFARATPEEAKYIARFVVGKLRLGVADMTLLEALS
EAFGVGKEALERAYHVWPDMGKLARHVAEGRPLEEVKITPGVPVLPMLAQRLSSASEILA
KLGGAAVCEYKYDGERAQIHISGGSVKIFSRRLEDITHAYPDVVKAVKESVAAGEAILEG
EIVAVDPDTGDMLPFQELMHRKRKHEVAAAVESYPAVLNLFDVLYLDGEDLTGEPLIYRR
LRLSEVVHETEKVSIARWRLFDDPGEVDVFFHEAVSLGMEGLVCKSPTSIYEMGARGWNW
IKYKRDYKSEMIDTVDLVVVGAFYGRGKRAGLYGAFLLAAYDPQTDMFYTVCKVGSGFTD
ADLKKMYEVLQPYKIPHRHPRVVSKMTPDVWFTPQVVIEVIGAEITLSPLHTCCLGAVRP
GVGLAIRFPRFTGRYRTDKSPEQATTPAEMVELYKRQKKVAQPE
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
gtgcagtttggggagctggtgaaaaccctcgccgctgtggagtccaccacccagaggacc
accatggttaagctcctcacctccctcctcaagagggcgaggccggacgaggtggacaag
atagtctacttcgtgctgggggatctcaagcccccgtgggagggggtggagctgggcgtg
gctgagaagctctgtctcagggctgtttctaaggcggcgggtacgccgctgtctgagctg
gaggcagtctacaagcggactggggacgtgggcgaggcggccaggagagccctctccgcg
gctaagaggccgggtctcctggcgtttggccagcagaagcctctggaggtgtcggaggtg
tacgacaccctcctaaaggtggcgaaggcggcgggggagggggcgcaggacatgaagata
tcgcttctggcctccctcttcgccagagctacccccgaggaggctaagtacatcgccagg
tttgtggtggggaagctcaggctcggcgtcgccgatatgacgttgctggaggcgctctct
gaggccttcggcgtggggaaggaggccctcgagagggcgtaccacgtgtggccagatatg
ggcaagctggcgcgccacgtggccgagggccggcccctcgaggaggtcaagatcacgccg
ggggtccccgtactccccatgcttgcgcagaggctctccagcgcttccgagatcttggcg
aagctcggcggcgcggctgtctgcgaatataaatacgacggcgagagggcgcagattcac
atcagcggcggctcggtcaagatcttcagcaggaggctggaggacatcacccacgcctat
ccagacgtggtcaaggccgtgaaggagtccgtggcggcgggggaggccatactggagggg
gagatagtggcggtcgacccagatacgggggatatgttgccgtttcaggagctgatgcat
aggaagaggaagcacgaggtggcggcggctgtggagagctacccagcggttttaaacctc
ttcgacgtcctctacctagacggcgaggatctcacgggggagcccctcatctacagaagg
ctgaggctgtcggaggttgtgcatgagacggagaaggtctcgatagccaggtggaggctt
ttcgacgaccccggcgaggtagacgtcttcttccacgaggcggtctccctagggatggag
ggcttggtctgtaaatcccccacgtctatatacgagatgggggcccgggggtggaactgg
attaagtacaagagggactacaaaagcgagatgattgacaccgtggatctggtggtggta
ggcgccttctacggcagaggcaaacgggcggggctctacggcgccttcctcctagccgcc
tacgacccccagacggacatgttctacacagtgtgtaaggtggggagcggcttcaccgac
gcggacctcaagaagatgtatgaagtgctgcagccgtacaagatcccgcatagacacccg
cgggtggtctcgaagatgacccccgacgtctggttcaccccccaggtggtgatcgaggtg
atcggggcggagatcaccctctcgccgcttcacacctgttgcctcggcgccgtgaggccg
ggggtgggcctcgccattaggttccccaggttcaccggccggtacagaaccgacaaatcg
ccggagcaggccaccacgccggcagagatggtggagctctacaagaggcagaagaaggtg
gctcagcccgagtag

DBGET integrated database retrieval system