KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00004899G001Help
Entry
GSTEN00004899G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tng00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSTEN00004899G001
   00051 Fructose and mannose metabolism
    GSTEN00004899G001
   00052 Galactose metabolism
    GSTEN00004899G001
   00500 Starch and sucrose metabolism
    GSTEN00004899G001
   00520 Amino sugar and nucleotide sugar metabolism
    GSTEN00004899G001
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    GSTEN00004899G001
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    GSTEN00004899G001
Enzymes [BR:tng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     GSTEN00004899G001
Membrane trafficking [BR:tng04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    GSTEN00004899G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
undetermined
AA seq 959 aa AA seqDB search
MIAAQLLAYYFTELKDDQLKKIDKYLYSMRFSDETLKDVMNRFRREMEKGLGRDTNATAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVKVTQDKKQPVQMESQVCETPDDIIH
GSGSRLFDHVADCLGDFMEKQKIKDKKLPVGFTFSFPCAQSKLDEAVLLTWTKKFKASGV
EGMDVVQLLNRAIKKRGVSVRLGGTPTRSPQANGLCWFQDYEADIMAVVNDTRCEVGIII
GKRSRRRRGSERGGKGHIRRVLAGTGTNACYMEELRHMDLVEGDEGRMCINTEWGAFGDD
GSLEDIRTEFDREIDRGSLNPGKQLFEKMASGMYMGELVRLILVKMAKEGLLFEGRITPE
LLTRGKIETKHRALKPPSSRSCDQSTLNSALSRSRTKEGLKKCMEILTRLGVEPSDEDCL
AVRHVCAIVSFRSANLIAATLGGILARLKDNKGVGRLRTTVGIDGSLYKMHPQYARRLHK
TVRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQSRQIQQTLAEFRLSKAQLLEVKK
RMRAEIERGLRKKTHQEATVKMLPTFVRSTPDGSENGDFLALDLGGTNFRVLLVKIRSGK
RRTVEMHNKIYAIPIEVMQGTGEELFDHIVHCISDFLDYMGMKSARLPLGFTFSFPCHQT
SLDAGTLVTWTKGFKATDCEGEDVVELLREAIKRKEEFELDVVAIVNDTVGTMMTCAYEE
PTCEVGLIAGTGSNACYMEEMKNIEIVEGTEGAHWGAFGDNGCLDDIRTRYDKAVDENSL
NEGKQRYEKMCSGMYLGEIVRQILIDLTKRGFLFRGQISETLKTRGIFETKFLSQIESDR
LALLQVRAILQQLGLDSTCDDSIIVKEVCGTVSRRAAQICGAGMAAVVDKIRENRRLDHL
DITVGVDGTLYKLHPHFSRIFQQTVKDLAPKCDVNFLLSEDGSGKGAALITAVGCRQRE
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcggctcagctgctggcctactacttcaccgagctgaaggatgatcagctcaag
aagatcgacaagtacctgtactccatgcgcttctccgacgagacgctgaaggacgtgatg
aaccgcttccgcagggagatggagaaaggcctgggccgcgacaccaacgccaccgccacc
gtcaagatgctgcccaccttcgtgcgctccatccccgacggctcagagaagggcgacttt
atcgcgctcgatctgggaggctccagcttccggattctccgggtcaaggtcacccaggac
aagaagcagccggtccagatggagagccaggtctgcgaaacccccgatgacatcatccac
ggcagcggctcgcggctctttgatcatgttgctgactgtctgggcgacttcatggagaag
cagaagatcaaagacaagaagctgccggtgggcttcaccttctccttcccctgcgcccag
tccaagctggacgaggccgtcctgctgacctggaccaagaagttcaaagccagcggcgtt
gaaggcatggatgtggtgcagctcctgaacagggccatcaagaagagaggcgtgagtgtc
cgtctgggagggacgccgacgcgctcgccgcaagctaacggcctctgctggttccaggac
tacgaggccgacatcatggcggtggtgaacgacacgcgctgtgaagtcggcatcatcatc
ggtaagagaagccgcaggcggcgcggcagtgagcgcgggggcaaaggtcacatccgccgc
gtgcttgcaggaaccggaaccaacgcctgctacatggaggagctgcgccacatggacctg
gtggagggggacgaagggcgcatgtgcatcaacaccgagtggggggccttcggggacgac
gggtccctggaggacatccgcaccgagttcgaccgggagatcgaccggggctccttgaac
ccggggaagcagctgtttgagaagatggccagtgggatgtacatgggcgagctggtccgg
ctcatcctggtcaagatggccaaggaggggctgctgttcgagggccgcatcacccccgag
ctgctgaccagaggaaagatcgagaccaagcacagggcgctaaagcccccttccagccgg
tcatgtgatcaaagcaccctgaactctgcgttgtctcgctccaggaccaaagagggactg
aagaagtgcatggagatcctgacccggctgggcgtggagccttcggacgaggactgcctg
gccgtgcgccacgtctgcgccatcgtgtccttcaggtcggcaaacctgatcgccgccacg
ctggggggcatcctggcccggctgaaggacaacaaaggagtcgggcgcctgcgcaccacc
gtgggcatcgacggctccctgtacaagatgcaccctcaatacgcccgccgcctgcacaag
acggtgcgccgcctggtccccgactcggacgtgcgcttcctgctgtctgagagcgggagc
ggcaagggcgcggccatggtgacggcggtggcgtaccgcctggcggagcagtcgcgccag
atccagcagacgctagccgagttccgactcagcaaagctcagctgctggaggtgaagaag
cgcatgagggcggagatcgagcggggcctgaggaagaagacccaccaggaggccaccgtc
aagatgctgcccaccttcgtgcgcagcacgccggacggctcagagaacggagacttcctg
gctctggatctgggagggacaaacttccgggtgctgctggtgaagatccgcagcgggaag
cggcgcaccgtggagatgcacaacaagatctacgccatccccatcgaggtcatgcaggga
acgggcgaggagctcttcgaccacatcgtccactgcatctcggacttcctggactacatg
gggatgaagagcgctcgcctgccgctgggcttcaccttctccttcccctgccaccagacc
agcctggacgccgggaccctggtcacctggaccaaaggcttcaaggccaccgactgcgag
ggcgaagacgtggtggagcttctgcgggaggccatcaagaggaaggaggagtttgagctg
gacgtggttgccatagtgaacgacacggtggggaccatgatgacctgcgcctacgaggag
cccacctgcgaggtggggctgatcgcgggaaccggcagcaacgcctgctacatggaggag
atgaagaacatcgagatcgtggaggggaccgagggggcgcattggggcgccttcggggac
aacggctgcctggacgacatcaggaccagatacgacaaggccgtggacgagaactctctg
aatgagggcaagcagaggtacgagaagatgtgcagcggcatgtacctgggcgagatcgtc
cggcagatcctgatcgacctgaccaagaggggcttcctgttccgggggcagatctccgag
acgctgaagaccaggggcatcttcgagaccaagttcctgtcgcagatcgagagcgaccgc
ctggcgctgctgcaggtcagggccatcctgcagcagctggggctggacagcacctgcgac
gacagcatcatcgtcaaggaggtgtgcggcaccgtgtcgcgccgcgccgcccagatctgc
ggcgccgggatggcggccgtggtggacaagatccgtgagaaccggcggctggaccacctg
gacatcaccgtgggcgtggacggcacgctctacaagctccacccgcacttctcccggatc
ttccagcagacggtcaaggacctggcgcccaaatgcgacgtgaacttcctgctctcggag
gacggcagcgggaagggcgccgccctcatcacggccgtgggctgccgccagagggag

DBGET integrated database retrieval system