KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00015073G001Help
Entry
GSTEN00015073G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:tng00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    GSTEN00015073G001
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GSTEN00015073G001
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    GSTEN00015073G001
   00430 Taurine and hypotaurine metabolism
    GSTEN00015073G001
Enzymes [BR:tng01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     GSTEN00015073G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
15
AA seq 583 aa AA seqDB search
MEVFGDNSCNPLGFLQKNNSLDEKSRLAGQKNMLACNNSERDARFRRTETDFSNLFARDL
LPAKNGEEPTIQFLLEMVDILTNYIKKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDQPE
SLEQILVDCRDTLKYGVRTGHPRFFNQLSSGLDIIGLAGEWLTSTANTNMFTYEIAPVFV
LMEQLTLKKMREMIGWPNGEGDGLFSPGGAISNMYSVMIARYKYFPEVKTKGMSAAPRLV
LFTSEHSHYSIKKAGAALGFGTENVILLSTDERGRVIPADLEAKIIDAKQKVSDIYLLCL
LLLCSPTFNRLFVFFFVRALFLQGYVPLFVNATAGSTVYGAFDPINEIADICEKYNLWLH
VDGAWGGGLLMSRKHRHKLSGVERANSVTWNPHKMMGVPLQCSAILVREKGILAGCNSMC
AGYLFQQDKQYDVTYDTGDKAIQCGRHVDIFKFWLMWKAKGTIGFEQHIDKCLDLSQYLY
NKIKNREGYEMVFDGVPQHTNVCFWYIPPSLRGMPDGDERREKLHRVAPKIKAMMMESGT
TMVGYQPQANKVNFFRMVVSNPAVTQSDIDFLIDEIERLGHDL
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggaggtttttggtgacaactcgtgtaaccctttagggttcctgcagaagaacaacagc
ctggatgagaagtcgcggctggcgggccagaagaacatgctggcgtgcaacaatagcgag
agggacgcgcgcttccggcgcaccgagaccgacttctccaacctgttcgccagagacctg
ctgccggccaaaaacggagaggagccgaccatccagttcttgttggagatggtcgacatc
ctgaccaactacatcaagaagactttcgaccgttccaccaaagtcctggacttccaccac
ccccatcagctcctggagggcatggagggcttcaacctggagctgtccgaccagccggag
tccctggagcagatcctggtggactgcagggacacgctcaagtacggcgtccggacaggt
cacccgcggttcttcaaccagctgtcttctggcctggacatcatcggtctggccggagag
tggctaacgtccacggcgaacaccaacatgttcacctatgaaatcgcccccgtgtttgtg
ctgatggaacaactgactctgaagaaaatgagagagatgattggctggcccaacggagaa
ggagacggacttttctcaccagggggcgctatttccaacatgtacagtgtgatgatcgcg
cggtacaagtatttcccggaggtcaagaccaagggcatgtctgcggctcctcgccttgtc
ctcttcacgtctgaacacagccactattccataaagaaggccggggcggctctgggcttc
ggtaccgagaacgtgatcctgctgagcacagacgagagggggagggtcatccctgcagat
ctggaggccaaaatcattgatgccaaacaaaaggtgagcgacatttacctcctctgtctc
ctccttctttgttcccccactttcaacagactatttgtcttttttttcgtgcgcgcgctc
tttctgcagggttacgtgccgctctttgtcaacgccaccgctggttccaccgtctacggc
gcctttgaccccatcaacgagatcgccgacatctgtgagaagtacaacctgtggctgcac
gtggatggagcgtggggcggcgggctcttgatgtccaggaagcatcgccacaagctgagc
ggggtggagagggccaactcggtgacgtggaaccctcacaagatgatgggcgttcctcta
cagtgctccgccatcctggtcagagagaagggcatcctggcaggctgcaactccatgtgc
gccggttacctcttccaacaagacaagcagtacgacgtcacctacgacaccggggacaag
gccatccagtgcgggcgacacgtggacatcttcaagttctggctcatgtggaaggccaag
ggcaccatcgggtttgagcagcacatcgacaagtgtttggatctgtctcagtatctgtac
aacaagatcaagaacagggaggggtacgagatggtgttcgacggagtgcctcagcacacc
aacgtttgcttctggtacatcccgcccagcctgagaggcatgcctgacggtgatgagcgg
cgggaaaaactgcacagggtggcgccaaagatcaaggccatgatgatggaatcgggtacc
accatggtgggctaccagccacaggccaataaggtcaacttcttccgcatggtggtgtcc
aaccctgcagtcacccagtctgacatcgacttcctcatcgatgagattgagaggttgggc
cacgacctg

DBGET integrated database retrieval system