KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00034627G001Help
Entry
GSTEN00034627G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K05625  
transglutaminase 2 [EC:2.3.2.13]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
Enzymes [BR:tng01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     GSTEN00034627G001
Cell adhesion molecules and their ligands [BR:tng04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     GSTEN00034627G001
   VLA-5
     GSTEN00034627G001
   VLA-9
     GSTEN00034627G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
undetermined
AA seq 646 aa AA seqDB search
LDIDHFDLECEYNNVEHRTDLNGIDRLIVRRGQAFSIRLYLRSGSYQPGVSALDCIAETG
PQPSEQYGTRAVFGLSAIINNSCWSAAVTSPPGDTLALSICSAPDAPIGRYSLTLGQLTR
IEFILLFNPWCPGDAVYMENERSLEEYILSQDGIIFRGTYKYPVPLPWNFGQFESNILDI
CLRTLDMNPKYLRNPGKDCSGRRNPIYVSRVLSAMVNCNDDDNGVLLGKWTDGYEGGVSP
LFWRGSVEILHNWDTQSCQPVRYGQCWVFAAVACTISRALGIPCRVVTNYASAHDTNGNL
VIERYIDEKGDLVRSGEMIWNYHCWVESWMTRPDLKSDFNGWQASDPTPQEKSDGVYCCG
PVPVKAIKEGELLLKYDAPFVYAEVNADVNTVMQKKDGSTSKVNTTTFVGQKISTKSIGS
DVREDITHLYKYPEGSEEEREVFKKANHHNKLLQQQQNQGLHIAIKVGTDMRKGCDFNVF
AVVTNNTHSEKKCRLVFGSCAVSYSGQVGGNCGFKDLLNVELAPGGEREVPLRLNYSKYG
NQLTDDNLIRLAILGEPKQNRRLAAEITLQNPLPEPLQDCCFSIEGANLTGGQVISERLN
SCVGPGEDAKVKIYFTPTHSGLRKLLVDFDSNKLCHIKGFRNVIIG
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
ctggatatcgaccactttgacctggagtgcgagtacaacaacgtggaacatcgcacggat
ctcaacggcatagaccgcttgatcgtgagaagaggtcaagcattctccatcaggctgtac
cttcgctccgggtcctaccaaccgggagtcagcgctctagactgcattgcagaaacaggt
ccccagccgtccgagcagtatggaaccagggctgtctttggtctgtctgctattattaac
aattcctgctggagcgctgcagtcaccagcccccctggagacacactggccctgtccatc
tgctctgcccctgatgcacctattggccgatacagcctgaccctcggacagttgacgagg
attgagtttatcctgctctttaacccctggtgtccaggagatgcggtgtatatggaaaat
gagcggagtttggaggagtacatattatctcaggatgggattatcttccgaggaacctac
aaatatcctgtacccctgccctggaactttggccagtttgagagtaacatcctggacatc
tgtttgaggacactggacatgaatcctaaatatctgaggaaccctggcaaagactgctca
ggaaggagaaatcccatctacgtgtcccgagtgctcagtgccatggtgaactgtaacgat
gatgataatggggtgttgttgggaaaatggacggatggctatgagggaggtgtcagcccc
ttgttttggagaggcagtgtggaaatcctgcacaactgggacacacaatcctgtcagcct
gttcgttacggccagtgctgggtttttgccgcggtggcctgtacaatttccagagctctt
ggcatcccttgcagagtcgtcaccaactatgcatcagcccacgataccaacggcaacctg
gttattgaacgctacattgacgaaaaaggagacctagttcggtccggagaaatgatctgg
aattatcactgctgggtggaaagttggatgaccagacctgacctgaaatcagattttaat
ggctggcaggccagtgaccccacacctcaggaaaagagcgatggtgtgtactgctgtggt
cctgtacctgtgaaagctatcaaggagggggagctgctcctcaaatacgacgccccgttt
gtctacgctgaggtaaacgctgacgttaacaccgtgatgcagaagaaggacggcagcaca
tccaaggtcaacaccacaacatttgtgggccagaagattagcacaaagagcataggcagt
gacgttagggaggacatcactcacctctacaagtaccctgaaggctctgaagaagagcgt
gaggtcttcaagaaggccaaccatcacaacaagctgctccagcagcagcaaaaccagggg
ctgcacatcgcaatcaaggtgggaacggacatgagaaagggatgcgatttcaatgtgttc
gccgtggtcaccaacaacacacacagtgagaaaaagtgtcgcctggtctttggatcctgc
gcggtgtcatacagcggccaggtgggaggaaactgcggtttcaaagacttgcttaatgtt
gagctggcaccaggaggagagagggaagttcctttaaggctgaactactcaaagtatggg
aaccagctcactgatgacaacctaatccgcctggcgatcctgggtgaacccaagcaaaac
cggaggctggccgcagagatcaccctgcagaaccctctgccagagccgctgcaggactgc
tgctttagcattgagggggccaacctcactgggggtcaagtcatctctgagagacttaat
tcctgtgtgggtcctggggaagacgccaaggtgaaaatctacttcactcccacacactct
gggctcagaaagctcctggtcgactttgacagcaacaagttgtgtcacatcaaaggcttt
agaaatgtcatcattgga

DBGET integrated database retrieval system