Talpa occidentalis (Iberian mole): 119243451 Help Entry 119243451         CDS       T07495                                  Symbol CXCL14 Name (RefSeq) C-X-C motif chemokine 14   KO K10033   C-X-C motif chemokine 14 Organism tod  Talpa occidentalis (Iberian mole) Pathway tod04060   Cytokine-cytokine receptor interaction tod04061   Viral protein interaction with cytokine and cytokine receptor tod04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:tod00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     119243451 (CXCL14)    04061 Viral protein interaction with cytokine and cytokine receptor     119243451 (CXCL14)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     119243451 (CXCL14)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tod04052]     119243451 (CXCL14) Cytokines and neuropeptides [BR:tod04052]  Cytokines   Chemokines    119243451 (CXCL14) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 DUF6355 NinB Motif Other DBs NCBI-GeneID:  119243451 NCBI-ProteinID:  XP_037365166 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MRLLTAALLLLLLALCAARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMLIITT KSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaggcttctgacggccgcgctgcttctgctgctcctggcgctgtgcgccgcgcgcgtg gacgggtcgaaatgcaagtgctcccgaaaggggcccaagatccgctacagcgacgtgaag aagctggagatgaagccaaagtacccgcactgcgaggagaagatgcttatcatcaccacc aagagcgtatccaggtaccggggtcaggagcactgcctgcaccccaagctgcagagcacc aagcggttcatcaagtggtacaacgcctggaatgagaagcgcagggtctacgaagaatag

DBGET integrated database retrieval system