KEGG   Tsukamurella paurometabola: Tpau_1308Help
Entry
Tpau_1308         CDS       T01228                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
tpr  Tsukamurella paurometabola
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Tpau_1308
   00650 Butanoate metabolism
    Tpau_1308
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tpau_1308
   00280 Valine, leucine and isoleucine degradation
    Tpau_1308
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Tpau_1308
Enzymes [BR:tpr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Tpau_1308
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Tpau_1308
Amino acid related enzymes [BR:tpr01007]
 Aminotransferase (transaminase)
  Class III
   Tpau_1308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1353806..1355158
Genome map
AA seq 450 aa AA seqDB search
MPTIDHRLPQVRELRTELPGPASRALAERRAAVIPAGVASTAPVYAADADGGVVVDVDGN
SLIDLGAGIAVTNVGASDPAVAEAIARQAARFTHTCFMVTPYEEYIAVAEQLVALTPGDG
PRRAVLFNSGAEAVENAVKVARHATGRNAVVAFDHAYHGRTNLTMALTAKSMPYKHGFGP
FASEVYRMPMSYPFRDPEGLTGAEAAARAITAIEKQIGGDQVAAVIIEPIQGEGGFIDPA
PGFLPALAAWCRENGVVFIADEVQTGFGRTGRWFACEEEGVVPDLITLAKGIAGGMPLSA
VVGRAELMDAVHPGGLGGTYGGNPVACAAALAAIGRMRELDLPGRAAELGARTKATLQEL
AATVPAVGDVRGRGLMLAIEFVGPDGVTPDAAITKAVAAACLKQGVLVLTCGTYGNVIRL
LPPLVIGEDTLADGVAVLAAAIRAEAGVPA
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgcccacgatcgaccaccgcctgccccaggtccgcgagctccgcaccgaactcccgggg
ccggcctcgcgggcgctcgccgagcgccgcgcggccgtgatcccggccggtgtcgcatcc
accgcaccggtgtacgccgcggatgccgacggcggtgtggtcgtcgacgtggacggcaat
agcctcatcgacctgggcgcgggtatcgccgtcaccaatgtgggcgccagcgatccggcc
gtcgccgaggccatcgcccggcaggcggcccgattcacccacacctgcttcatggtgacg
ccctacgaggagtacatcgccgtcgccgagcagctggtggcgctcacacccggcgacggt
ccgcgccgggcggtgctcttcaactccggtgccgaagcggtggagaacgccgtgaaggtc
gcgcgccacgccaccggccgcaacgccgtggtcgccttcgatcacgcctaccacggccgc
accaacctcacgatggcgctcaccgcgaagtccatgccctacaagcacggcttcggcccg
ttcgcgtccgaggtgtaccggatgccgatgtcgtacccgttccgcgatcccgaggggctc
accggggccgaggccgccgcccgcgcgatcaccgcgatcgagaagcagatcggtggtgac
caggtggccgccgtgatcatcgagccgatccagggcgagggcggcttcatcgaccctgca
ccgggattcctgcccgccctcgcagcctggtgccgcgagaacggcgtcgtcttcatcgcc
gacgaggtgcagaccggcttcggccgcaccggccgctggttcgcctgcgaggaggagggc
gtggtgcccgacctcatcacactggccaagggcatcgccggcggtatgccgctgtcggcg
gtggtgggccgcgccgaactcatggacgcggtgcatcccggtggcctcggcggcacctac
gggggcaaccccgtcgcctgcgccgcggccctcgccgcgatcggccgcatgcgcgagctc
gatctgcccggtcgcgccgcggagctcggcgcccgtacgaaggccacgctgcaggagctg
gccgccacggtccccgccgtcggcgatgtgcgcggccgcgggctgatgctcgcgatcgag
ttcgtcggcccggacggtgtgacccccgatgccgcgatcacaaaggcggtcgccgcggcc
tgcctcaagcagggcgtgctggtgctcacctgcggcacgtacggcaatgtgatccggctg
ctgccgccgctggtgatcggcgaggacaccctcgccgacggtgtcgccgtactcgccgcc
gccatccgcgctgaggccggggtgcccgcgtga

DBGET integrated database retrieval system