KEGG   Tsukamurella paurometabola: Tpau_2536Help
Entry
Tpau_2536         CDS       T01228                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
tpr  Tsukamurella paurometabola
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tpau_2536
  Energy metabolism
   00680 Methane metabolism
    Tpau_2536
Enzymes [BR:tpr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Tpau_2536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2627920..2630685)
Genome map
AA seq 921 aa AA seqDB search
MTSEPARAATEPLRDDIRLLGGILGDTVREQAGERIFDLVENARQESFRVRRSEIDREQL
AAMFTDLPTAEAVPVIRALSHFALLANLAEDLHRERRRAIHVRAGEAPQASSLAHTYTLL
EDAGLDGDAVRAALRHALVVPVITAHPTETRRRTVFDTQHRITELMRYRDRTQLDPREEE
QVQVNLRRQILTLWDTALVRLERLRIQDEVVNGLRYFDAAFLEVMPQINHEIRTRLRELY
PGTGLLSEPILRPGSWIGGDRDGNPYVTGEVVTMASRRAAATALEHYLRQLLELEKELAL
SLRLTTVSDELLALAEWDTSPKQADEPYRRALRWIRGRLSTTAADLLDEPLDAGIDIDAP
RYGGPSELLADLAVVDASLRTAGDGLIADARLQDLREALNTFGFHLSGLDMRQNSDVHEE
TISELFAWAGVHPDYASLDESDRVRLLTDELRLRRPLVGPGAEFTEQTAKELGVLHAAAD
AVANLGPGAVPNYIISMCTSVSDLLEAAVLLKEAGLLRPGDGSAADAVATCSVNIVPLFE
TIEDLQQGAATMRAAFEVPVYRSLVDGKGGLQEIMLGYSDSNKDGGYLAANWALYRAELD
LVAMARDAGVTLRLFHGRGGTVGRGGGPSYDAILAQPPGAVRGTLRLTEQGEIIAAKYAE
PALATRNLESLLAATLESTLLDVEGLGDDAEEAYAVLDELAALAREAYGDLVHRTDGFVE
YFTTSTPVEEIGSLNIGSRPSSRKQTSKISDLRAIPWVMAWSLSRVMLPGFYGTGAAIEK
WIDGGPSRLEQLRALYRRWPFFQTVLSNMAQVLAKSDLGLAARYAELVPDAALRERVFGK
IADEHRRTIEMYYAIAETDDLLADNPALKRSVFNRFPYLEPLNHLQVELLRRYRAGDTDP
QVQRGILLTMNGLATALRNSG
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtgagcccgcgcgcgcagcaacagaacccctccgtgacgacatccgtctgctc
ggcgggatcctcggggacaccgtccgcgaacaggccggcgagcgcatcttcgacttggtg
gagaacgcccgccaggagtccttccgggtacggcgctccgagatcgaccgcgagcagctc
gccgcgatgttcaccgatctgcccaccgccgaggcggtcccggtgatccgggccctctcc
cacttcgcgctcctcgccaacctcgccgaggacctgcatcgcgaacgccggcgcgcgatc
cacgtgcgggcaggggaggcgccgcaggcctcgtcgctcgcgcacacctacacgctgctg
gaggacgcgggactcgacggggacgccgtccgcgccgcgctccggcatgcactggtggta
cccgtcatcaccgcgcatcccaccgagacccggcgccgcaccgtcttcgacacccagcat
cggatcaccgagctgatgcggtatcgggaccgcactcaactcgatccccgcgaggaggag
caggtgcaggtgaatctgcgccggcagatcctcaccctgtgggacaccgccctggtgcgg
ctggagcggctgcggatccaggacgaggtggtcaacggactgcgctacttcgacgcggcc
ttcctggaggtgatgccgcagatcaaccacgagatccgcacccgcctgcgcgagttgtac
ccgggcaccggcctgctgtccgagccgattctgcggcccggctcgtggatcggcggcgac
cgcgacggcaatccgtacgtcaccggggaggtggtcaccatggcctcccgccgggccgcc
gccacggcgttggagcactacctgcgacagctgctcgaactggagaaggaattggccctc
agtctgcgcctgaccaccgtgtccgacgagttgctcgccctcgccgagtgggatacctcg
ccgaagcaggccgacgagccctaccgtcgcgcgctgcggtggattcgcggccgtctctcc
acgaccgccgccgacctgctcgacgagccgctggacgcggggatcgatatcgatgctccc
cgctacggcggaccgtcggaactgctggccgatctcgccgtcgtggacgcctccctgcgc
accgcgggcgacggcctgatcgccgatgcgcggctgcaggaccttcgggaagccttgaac
accttcggtttccacctgtcgggccttgatatgcggcagaactcggacgtccatgaggaa
accatctccgagctattcgcctgggccggcgtgcatcccgactacgcctcgctcgacgag
tctgaccgcgtgcgcctgctcaccgatgagctgcggctgcgccgccccctggtggggccg
ggcgccgaattcaccgagcagaccgcgaaagaactcggtgtgctccatgccgccgccgac
gcggtcgcgaacctcggccctggtgccgtgccgaactacatcatctcgatgtgcacgtcg
gtatcggatctgctggaggcggcagtgctgctcaaagaggcaggcctgctccggccggga
gatggctccgctgccgacgcggtcgcgacctgctcggtgaacatcgtcccactgttcgag
accatcgaagatctgcaacagggggcggcgacgatgcgcgcggccttcgaggtgccggtg
tatcgatcgctggtggacggcaagggcggactgcaggagatcatgctgggctacagcgac
tccaataaggacggcggctatctcgcggcgaactgggcgctgtaccgcgccgaactcgac
ctcgttgcgatggcccgcgacgccggggtcacgctgcgcctgttccacggtcgtggcggc
acggtggggcgcggcggcggccccagttacgacgcgatcctggcgcagccgcccggcgcg
gtccgcggcacgctgcgactgaccgagcagggcgagatcatcgcggcgaagtacgcagag
cccgcactcgccacccgcaacctggaatcgctgctcgcggcgacgctggagtccaccctg
ctcgacgtcgaggggctcggcgacgatgcggaggaggcctatgccgtactcgatgaactc
gccgctctggcgcgcgaggcctacggcgatctggtgcaccgcaccgacggtttcgtcgaa
tacttcaccacgtcgacgcccgtcgaggagatcggctcgctgaacatcgggtcgcgaccc
agttcgcgtaagcagacctcgaagatctcggacttgcgggcgatcccctgggtgatggcc
tggtcgctctcgcgggtcatgctccccggcttctacggcaccggcgccgccatcgagaag
tggatcgacggcggtccctcccgcctggagcagttgcgtgccttgtaccgccgctggccg
ttcttccagaccgtgctctcgaacatggcgcaggtgctggcgaagtccgatctcgggctg
gcggcgcggtacgccgagctggtgcccgatgcggcgctgcgtgagcgggtgttcggcaag
atcgccgacgagcatcgccgcaccatcgagatgtactacgcgatcgctgagaccgacgac
ctgctcgccgataatcccgcgctcaagcgttcggtgttcaaccggttcccgtatctggaa
ccgctcaaccacttgcaggtggagctgttgcgcaggtaccgcgccggagacaccgatccg
caggtccagcgcggcatcctgctcaccatgaacggtctcgcaacggcactccggaattcg
ggatag

DBGET integrated database retrieval system