KEGG   Thermacetogenium phaeum: Tph_c18560Help
Entry
Tph_c18560        CDS       T02276                                 

Gene name
alr1
Definition
(GenBank) alanine racemase Alr
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
tpz  Thermacetogenium phaeum
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tpz00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Tph_c18560 (alr1)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Tph_c18560 (alr1)
Enzymes [BR:tpz01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Tph_c18560 (alr1)
Peptidoglycan biosynthesis and degradation proteins [BR:tpz01011]
 Precursor biosynthesis
  Racemase
   Tph_c18560 (alr1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1872140..1873285)
Genome map
AA seq 381 aa AA seqDB search
MKRPAWIEIDLSVLCSNVRELRRITNPRADVMAVVKANGYGHGLEEVSRAALKSGASWLG
VALLQEALALREKGITAPILVLGYTPREYAEDVVRNDVSQTVTAWEDAVALAAAARRLRK
RAKVHIKIDTGMGRLGFYPNRDTLEVICRLARLPGLEVEGIYTHFATADEEDKSYTEEQF
ARFQHLLKELAARQLFIRWKHCANSAALIDLPFTHLDLVRPGIAIYGYYPSSHVRHDLIS
LKPVMSLKARLAFVKEVPAGSRISYGGTFITRQRTRIATVPLGYGDGYSRLLSGKSEVLV
KGVRAPVVGRICMDQLMVDVGHIPDVKQGDEVVLLGRQGEEEITAEELAKKLDTITYEVL
CMLSVRLPRIYLNGSDSCCRC
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgccccgcctggatcgagatcgatttatcggtgctctgcagcaatgtgcgggag
ctgcgccggatcaccaacccccgggcggacgttatggccgtcgtcaaggccaacggctac
gggcatgggctggaagaggtttcccgggcggctctgaagagcggtgcctcctggttgggc
gtagccctgctgcaggaggcactggcattgcgggaaaaggggatcaccgctcctattctg
gtgctcggttataccccgagggaatacgccgaagatgtcgtccgaaatgacgtcagccag
acggtgacggcctgggaggacgccgtggccctggctgccgccgcccgtcgcctgagaaaa
agggcgaaggtccatataaagatcgataccggaatggggcgcctcggtttctatccgaac
cgggacaccctggaggtgatctgccgcctggcccggctgccggggctcgaggtggagggc
atatacacccattttgcgacggccgatgaggaggataagtcctatacggaggagcagttc
gccagatttcagcaccttctgaaagaactggcggcgcgccagctgttcatcaggtggaaa
cactgcgccaactccgctgctcttatcgaccttcccttcacccatctggatctggtgcgg
ccggggatcgccatttacggctattacccgtcctcccacgtcaggcatgacctgatcagc
ctgaagcctgtgatgagcctgaaggcgcgcctggccttcgttaaggaggtccctgcaggg
agcagaattagttatggtggcacctttatcaccaggcagaggacgcgcatcgccacagtg
cctcttggctacggggatggctactccaggcttttatccggcaagagcgaggttctcgtc
aagggggtgcgcgctcctgtcgtcgggcggatctgcatggatcagttgatggtggatgtc
ggccatattcccgatgtgaaacagggtgatgaggtggttctgctgggcaggcagggtgag
gaggagattaccgccgaggaactggcaaagaagctggacaccatcacctatgaagtgctg
tgtatgctcagcgtcaggctgccccggatctacctgaatgggtctgattcttgttgccga
tgctga

DBGET integrated database retrieval system