KEGG   Thermomicrobium roseum: trd_0308Help
Entry
trd_0308          CDS       T00845                                 

Definition
(GenBank) superoxide dismutase (Mn)
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
tro  Thermomicrobium roseum
Brite
Enzymes [BR:tro01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     trd_0308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(313147..313764)
Genome map
AA seq 205 aa AA seqDB search
MPYELPPLPYPYDALEPYIDARTMEIHHTGHHGAYVRNVNAALEKHPEIPGMPIEELLRR
INEVPEDIRTAVRNNGGGHANHTIFWQIMGPNAGGEPTGELAQAIAETFGSFQQFKEQFS
AAAAGVFGSGWAWLVLDQNGKLQIITRPNQDSPYMDNLYPVMGLDVWEHAYYLKYQNRRP
EYIANWWNVVNWDAVAQRYREGLKR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgccgtacgaactcccaccgctgccgtatccgtacgacgcgctcgagccctacatcgat
gcgcgcacgatggagattcatcacaccgggcatcatggagcctacgtgcgcaacgtgaac
gcggcgctcgaaaagcacccagaaatcccgggcatgccgatcgaggaactcctgcgccgc
atcaacgaagtgcctgaggatatcaggaccgctgtccgcaacaacggtggaggccacgcc
aaccataccattttctggcagatcatgggtcccaacgctggtggtgaaccgaccggagag
ctggcgcaggcgatcgctgaaacgttcgggagcttccagcagttcaaggaacagttctcg
gcagctgccgcaggggtcttcggttcaggatgggcgtggttggtactcgatcagaacggc
aagctccaaatcattaccaggcccaatcaagacagcccctacatggacaacctctatccc
gtgatggggctggacgtctgggagcatgcctattacctcaagtaccagaaccgccgtcct
gagtacatcgcgaactggtggaacgtggtcaactgggacgcggtggcccagcgctatcgt
gagggtctcaagcgctga

DBGET integrated database retrieval system