KEGG   Terriglobus roseus: Terro_0853Help
Entry
Terro_0853        CDS       T02140                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
trs  Terriglobus roseus
Pathway
trs00500  Starch and sucrose metabolism
trs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:trs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Terro_0853
Enzymes [BR:trs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Terro_0853
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Terro_0853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C APH DUF3459 Soc Glyco_hydro_77 Cyc-maltodext_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AFL87180
UniProt: I3ZD62
LinkDB All DBs
Position
complement(961368..964607)
Genome map
AA seq 1079 aa AA seqDB search
MSAAITRPKRKKPGSATDPLWYKDAVIYELHVKAFADGNNDGIGDFPGLLGKLDYLQELG
VTCIWLLPFFPSPQRDDGYDISDYLSVNPAYGDIDDFKAFLAAAHQRGMQVLIELVINHT
SDQHPWFQAARNSPKGSPEREMYVWSDTDKLYDGVRIIFTDTEKSNWTWDPVAQQYYWHR
FFSHQPDLNFDNPRVMEEVLNAMRFWMDMGVDGLRLDAIPYLIERDGTSCENVPETHVKI
KQIRAAIDAEYENRLVLAEANMWPEDVLPYFGDGDECHMAFHFPLMPRIYMALRQEDRLP
ITEIMARTPPVPEGCQWGLFLRNHDELTLEMVNDEERDYMYLAYSADPRMRINVGIRRRL
APLVDNNRRRIELLNSLLLSFPGTPILYYGDEIGMGDNIYLGDRNGVRTPMQWNSDRNAG
FSRAVPAMLYSPVIMDPIWGYEAINVEAQESDTSSLLHWTRNMIALRKLFQVFGRGTQEF
LKPENRKILAYVREYESERVVCVANLSRFAQPVTLDLSRFAGMVPVEMLGYVPFPKVDAS
PYALTLAPYGFLWLEMQPAPEIDMEAAPPEIKDAALVLPAGDLIGAVTGAGAELLQETFL
PKYLQAQRWFGAKSRTVKNVCITDVVPIDDMDAAILLLRIDYTEGESDVYSVPVAAITGE
HAEDLLLEAPHSIIAGMQMGAQSAGALVDALVIPEIRDALLEMIERGHQKTTRCDGILRG
EASSAFAELRGEGEIPSRRSSAEQSNTSLLYDGKLILKIFRRLQTGENPDAEIGRFLTEV
ANFEHIAPFAGQLVYTAKDSTEATTIGLLQGLVPNDGDGWEWTLAQIQSTKTGEPTNYAE
AANLLGKRTGEMHVALATATTNPAFACDGTDASSLDRDAVRLEAQIAVAVNAIKNRFAAL
PDDLLGPAATLLSKRTEMLAVADALRRIAGAQAGIRIRIHGDYHLGQVLRTKDDFVLLDF
EGEPARSLEERRAKQSPWRDVAGMMRSFSYAGAAGFGTTSSEERTAWERAATDAFLQGYH
QGSEGIPSGEQTVAKQLLRAFLLEKALYEIVYEVNNRPDWIAIPLTGILDLLRTVGDEA
NT seq 3240 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgcagccattacacgtccgaaacggaagaagccaggtagcgccacagatcccttg
tggtacaaagacgcggttatctatgagttgcacgtcaaggcatttgctgacggcaataac
gacggcatcggtgacttccccggtctgttggggaagctcgactacctgcaggagttaggc
gtcacctgcatctggcttttgccattcttcccgtcgccgcagcgtgatgacggctatgac
atcagcgactacctgagcgtcaatccagcctacggcgacattgacgacttcaaagcgttc
ctggccgctgcgcaccagcgcggcatgcaggtgctgatagagctggtcatcaatcacacc
agcgaccagcatccctggttccaggcggcgcgcaattcgccgaagggctcgcccgagcgc
gagatgtacgtttggagcgacaccgacaagctgtatgacggggtccgcatcatcttcacc
gatacggaaaagtccaattggacttgggacccggttgcgcagcagtactactggcaccgc
ttcttctcgcaccagccggatctaaacttcgacaatccgcgcgtcatggaagaagtgctg
aacgccatgcgcttctggatggatatgggcgtcgatggactccgcctggacgccatccca
tacctcatcgagcgtgacggcaccagttgcgaaaacgtgcccgaaacgcacgtcaagatc
aagcagatccgcgccgccatcgatgcggaatacgaaaaccgtctggttttggcagaagcc
aacatgtggccggaagacgtgcttccatacttcggcgacggtgacgagtgccacatggcc
ttccacttcccgctcatgccgcgaatttacatggcgttgcggcaggaagaccgtctgccc
atcacggaaatcatggcgcgcacgccacccgtcccggaaggctgccagtggggtctcttc
ctgcgcaatcatgacgagctaaccctcgaaatggtgaacgacgaagagcgcgactacatg
tatctcgcctattcggccgatccgcgtatgcgcatcaacgtgggcatccgccgcagactc
gcgccactcgttgataacaaccgtcgtcgtatcgaactgctgaactctctgctgctctct
ttcccgggcacgccgattctctactacggcgatgagatcggcatgggcgacaacatctac
ctgggcgatcgcaacggtgtacgcacgcccatgcagtggaacagcgatcgcaacgccggc
ttcagccgtgcggtgcccgcgatgttgtactcgccggtcatcatggatcccatctggggt
tacgaagcgatcaacgtcgaagcgcaggagagcgacacctcgtcgctgctgcactggaca
cgcaacatgatcgctttgcgtaagctcttccaggtcttcggccgcggcacgcaggagttc
ctcaagccggagaatcgcaagatcctcgcgtacgtccgcgagtacgaatccgagcgtgtc
gtctgcgtcgccaatttgtcacgctttgcccagccggtcactctggacctgagccgcttc
gccggcatggtgccggtagaaatgctgggctacgttccatttccgaaggtggatgcaagc
ccctacgcgctcactctcgctccatacggcttcctctggctcgaaatgcaaccagcccct
gagatcgacatggaggctgcaccgcctgagatcaaggacgcggctctcgtcctgcctgcg
ggcgatctcatcggtgccgttacaggtgcaggcgcagaactgctgcaggagacctttctt
ccgaagtacctccaggcgcagcgctggttcggtgcgaagtcgcgcacggtgaaaaacgtc
tgcatcactgacgtggttcccatcgacgacatggacgcagccatactactgctgcgcatt
gactataccgaaggcgagagcgacgtttactccgtcccggttgccgcgattacgggcgag
cacgccgaagacctgcttctggaagctccgcatagcatcatcgcgggcatgcagatgggc
gcacaatctgcgggtgcactggtcgacgcactggtcattccagagatacgcgacgcactg
ctggagatgatcgaacgcggtcaccagaagaccacccgttgcgatggcattctgcgcggc
gaggcaagctctgcctttgccgaactgcgcggagaaggcgagatcccttcgcgccgcagc
tctgcagaacagagcaacacctctttgctctacgacggcaagctgatcctcaagatcttc
cgccgcctgcaaacgggtgagaaccccgatgcggagatcggtcgcttcctgaccgaggtc
gccaacttcgaacacatcgcccccttcgctggccaattggtctacaccgcaaaggacagc
acggaggcgacgaccatcggcctcctccagggcctggtgccgaacgacggcgatggatgg
gagtggacgctcgctcagattcaatcgaccaagacgggcgaaccgaccaactacgccgaa
gcagcgaatctcctgggcaaacgcaccggtgaaatgcacgtcgccttggcgaccgcaaca
accaaccctgccttcgcttgcgacggcacggacgcatcttccctggaccgcgacgctgta
cgcctggaagcgcagattgcggttgccgtgaacgccatcaagaaccggttcgcagcactg
ccggacgatctgctgggaccggcagcgaccctcctcagcaaacgtacggagatgctcgcg
gtagccgatgcgctgcggcgcattgccggagcacaggctggcatccgcatccgtatccac
ggcgactaccacctgggtcaggtcttgcgcaccaaggatgatttcgttctgctggacttt
gaaggcgaaccggcgcgttcgctggaggagcggcgagcaaaacaatcaccctggcgcgac
gtcgccggcatgatgcgatcgttctcgtacgcgggtgcagcaggctttggaacaacaagc
tccgaagaacgcaccgcctgggaacgcgcagcgactgacgccttcctccagggctaccat
cagggatcggaaggtataccgtcgggtgagcagacagtcgcaaagcaattgctacgtgcc
ttcctgttggagaaggcactctatgagatcgtgtacgaagtgaacaaccgtccagactgg
attgcgatcccgcttaccggcatcctggacctgctccgtacggttggagacgaagcatga

DBGET integrated database retrieval system