KEGG   Takifugu rubripes (torafugu): 101065981Help
Entry
101065981         CDS       T02386                                 

Definition
(RefSeq) sialidase-4-like
  KO
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101065981
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101065981
Enzymes [BR:tru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     101065981
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
11
AA seq 471 aa AA seqDB search
MRSPYFPARTVLFHKEPNGVTYRVPALLYLSRSRCFLAFCEQRLSPSDSQAHLLVMRKGT
FYRNYVEVGELFTTALLPGHRSMNPCPVYDEFTGTLFLFFIAILGHTSESYQLRTGKNLS
HLCFICSTDEGETWSPVTDLTKKVIGDTIKEWATFALGPGHGIQLKSGRLLIPAYSYHID
CRECFGQLCLTTPHAFCFHSDNHGRTWRFGEAVPGPESVECQVVSVDEEDGTNVLYCNAR
SPLGYRVQALSLDDGAVFQEGQLVQRLVEPRNGCHGSIIGFPAPVHLLQNPEGAPQCRHW
TSFLTLNHPDFPTYSSTVSTNHRVSPDFLTPTWVVYSHPTWSASRMDLGVFLSLFPRDPD
SWRGPWVIYEGPSAYSDLAYLELPTSPGSPPVVAFACLFECGPKTAYDEICFCIFTLYEL
IDNLPQNGQQRNCDGARTSQSRSSGSRDAQRASVGRRVKKKSKLRERCSVC
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcggtcgccatacttccccgcgaggactgtgcttttccacaaggagcccaatggagtg
acctacagggtcccagcgctgctctacttgtcccggtccagatgcttcctggctttctgt
gagcagagactcagcccctcggactctcaggctcacctgctggttatgaggaaaggcacg
ttctacaggaactatgttgaggttggtgaactcttcaccactgccctcctgccgggtcac
cggtccatgaacccatgcccggtgtacgacgagttcacaggtactctgttcctgttcttc
atcgccattctgggccacacctcagagtcataccagctgagaacagggaagaatctgagc
catctttgcttcatctgcagcactgacgagggagaaacctggagtccagtcacagacctc
actaagaaggtcataggtgacaccatcaaagaatgggccacctttgcgctcggaccaggt
cacggcatccagctcaagtccggacgcctcttgattccagcctactcctaccacatcgac
tgcagagagtgtttcggccagctctgcctcaccacgccccacgctttctgctttcacagt
gacaaccacgggcgcacctggcgtttcggggaggcggtgccggggccggagagcgtggag
tgccaggtggtgtctgtggatgaagaagatgggaccaatgtgttgtactgcaacgcccgc
agccctcttggatacagggtgcaggccctcagcctggacgatggagcggtctttcaggag
gggcaattggtgcagcggctggtggagcccagaaatggttgccatggtagcattattgga
tttcctgccccggtacatctgctgcagaatccagaaggggcacctcagtgcagacactgg
acttccttcttaactttgaatcaccccgactttcctacatactcaagcaccgtttcaacc
aatcacagggtctctccagacttcctcacccctacatgggtggtatactctcacccgaca
tggagtgcctcacgcatggatctgggtgtttttctcagcctatttccacgtgatcctgac
agttggcgcggcccgtgggtgatatacgagggccccagtgcctattctgacctggcctac
ctcgagctgccgacctcccccggctccccgccagtcgtggctttcgcctgcctgttcgag
tgcggcccgaaaacagcctacgacgaaatctgcttctgcattttcaccctgtacgaactg
atcgacaacctgccgcaaaatgggcagcagagaaactgcgacggtgccaggacaagccag
agccggagttcaggaagcagagatgctcaaagggcatcagttggtcgtcgggtgaaaaag
aagagcaagctgcgtgagaggtgctctgtgtgttaa

DBGET integrated database retrieval system