KEGG   Takifugu rubripes (torafugu): 101067705Help
Entry
101067705         CDS       T02386                                 

Gene name
hk1
Definition
(RefSeq) hexokinase 1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101067705 (hk1)
   00051 Fructose and mannose metabolism
    101067705 (hk1)
   00052 Galactose metabolism
    101067705 (hk1)
   00500 Starch and sucrose metabolism
    101067705 (hk1)
   00520 Amino sugar and nucleotide sugar metabolism
    101067705 (hk1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101067705 (hk1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101067705 (hk1)
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     101067705 (hk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
13
AA seq 918 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYSMRFSDETLLDIMHQFRREMVKGLGRDTNPTAA
LKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVSHEKKQTVQMESQIYDTPEDIIH
GTGTKLFDHVAECLGDFMEKHNIKDKKLPVGFTFSFPCQQTKLDEGVLITWTKRFKASGV
EGMDVVKLLSKAIKKRGNYDAEIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRNIDLVEGDEGRMCVNTEWGAFGDDGRLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YLGELVRLILVKMAREGLLFEGRITPELLTRGKFETKHISAIEKSKEGLSKAKEILTRLG
VEPSTEDCIAVQHVCTIVSFRSANLIAAVLAGILLRLKENKGMTRLRTTIGIDGSLYKMH
PQYARRLHKTVRRLVPDIDVRFLLSESGSGKGAAMVTAVAYRLAEHSRQIAEILSEFRLT
TEQLLEVKHRMRNEIQNGLSKNTQDIATVKMLPTFVQSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPLEVMQGTGEELFDHIVQCISDFLDYMGMKNTRLPLGF
TFSFPCQQTSLDAGILVTWTKGFKATDCEGEDVVGLLREAIKRREEFDLDVVAIVNDTVG
TMMTCAYEEPTCQVGLIAGTGSNACYMEEMKNVEMIDGEKGQMCVNMEWGAFGDNGCLDD
IRTEYDRMVDDFSLNPGKQRYEKMCSGMYLGEIVRNILIDMTKRGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRSILQHLGLDSTCDDSIIVKEVCGTVSRRAAQLCGAGMAA
VVDKIRENRGLDHLNITVGVDGTLYKLHPHFSKIMHQTVKELAPQCNVNFLLSEDGSGKG
AALITAVGCRLRQELNNK
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgattgctgcacagctactagcttattacttcaccgaactcaaagatgaccaggtcaaa
aagattgataagtacttgtactccatgcgcttctctgatgaaacgttactggacatcatg
catcagtttcggagggaaatggtaaaaggactgggtcgagacacaaacccaactgctgcc
ctgaagatgctgcccacctttgtgcgttcaatccccgatggttcagaaaagggagatttt
atcgctctggatttgggaggcagcaacttcaggatcctccgtgttaaagtgagccacgag
aagaaacagaccgtccagatggagagtcaaatttatgacacgccagaggacatcattcat
ggcaccgggacaaaactgtttgaccatgtggcagagtgcctcggcgacttcatggaaaaa
cacaacatcaaagacaagaagcttcctgtggggttcaccttctccttcccctgccagcag
actaaactggatgagggcgtcctgataacctggacaaagcgcttcaaggccagtggagtg
gagggaatggacgtggtcaagctgctcagcaaagctattaagaaacgtggaaactatgat
gctgagatcatggcagtggtaaatgatactgtgggaacaatgatgacgtgtggatttgat
gaccaacgctgtgaagtaggaatcatcatcggcacgggcacaaatgcgtgctacatggaa
gagctgcgaaacattgacctggtggagggagacgagggcaggatgtgtgtgaacaccgag
tggggggcgtttggagacgatggcagactggaggacatcaggacagagtttgacagagaa
atcgacagaggctctctcaaccccggcaagcagctatttgagaagatggtcagtgggatg
tatctgggcgagttggtgcgtctcatactggtgaagatggccagagagggcctgctgttc
gagggcaggatcacgcccgagctgctcacgagaggcaagtttgagaccaaacacatctcg
gccattgagaagagtaaggaggggctgtcaaaggccaaagagatcctgaccagacttggg
gtggagccttcaactgaagactgcatcgctgtacagcatgtttgcaccattgtgtctttc
cgctctgccaacctgatagctgctgtcctggcaggcattctgctcagactaaaggagaac
aaaggtatgacacggttgaggaccaccataggcatcgatggatctctgtacaagatgcac
ccacagtacgcccgtcgcctccataagacagtccgtcgtttggtcccggatattgacgtt
cgattcctcctgtcagagagtgggagcggaaagggtgctgccatggtgacggcagtggct
taccgtctagccgagcattcgcgacagattgcggaaatactgtcagaatttaggctaacg
acagaacagctgctggaggtgaagcaccgaatgagaaatgagatacaaaatggcctttca
aagaacacacaggacattgctaccgtcaaaatgctgccaacctttgttcaaagcacacca
gatggcacagagaatggagacttcctggctttggatttaggaggaaccaacttcagagtt
ctcttggtcaagattcgttctgggaagagaagaacggtggagatgcacaataagatctat
gctattcctctggaagtgatgcagggcacaggagaggagttgtttgatcacatagtgcag
tgtatcagcgacttcctcgactacatgggcatgaagaacacccgtcttcctctgggattc
accttctccttcccctgtcaacagaccagcctggacgctggtatccttgttacatggact
aaaggattcaaggctacagactgtgaaggagaggatgtggttggactgctgagggaggct
attaagaggagagaggaatttgacctggatgtggtggctattgtgaatgatacagtggga
accatgatgacctgtgcctatgaggagcctacctgtcaggtcgggctgattgcaggcacc
gggagtaacgcctgttacatggaggagatgaagaatgttgagatgatagatggagaaaag
ggacagatgtgtgtcaatatggagtggggggctttcggagacaacggatgcctggatgac
atcaggacagagtacgaccgaatggtggatgacttctccctcaatccaggcaaacaaaga
tatgagaaaatgtgcagtggcatgtatctgggtgaaattgtgcgaaacatcctgatagat
atgaccaagagaggattcttgttccgagggcaaatttctgaaacactcaaaactagaggc
atctttgaaacaaagttcctctcacagatagagagtgacaggctggctttgctgcaggtg
agatccatcctgcaacacttggggctagacagcacctgtgatgacagtattatagtcaaa
gaggtgtgtggaaccgtgtcacggcgcgccgctcagttgtgcggcgcaggaatggcagct
gtcgtcgataaaatcagagagaaccgtggactggaccatctgaacatcacggtgggggtg
gacggcacgctctacaagctccatccccacttctccaagatcatgcaccagacagtaaag
gaactggcccctcagtgcaacgtcaactttctcttgtcagaggacggcagtggaaaaggg
gcagcactcatcacagctgtgggctgtcggctaagacaggagctaaacaataaatag

DBGET integrated database retrieval system