KEGG   Takifugu rubripes (torafugu): 101070514Help
Entry
101070514         CDS       T02386                                 

Gene name
hdac8
Definition
(RefSeq) histone deacetylase 8
  KO
K11405  
histone deacetylase 8 [EC:3.5.1.98]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101070514 (hdac8)
Chromosome [BR:tru03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     101070514 (hdac8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
8
AA seq 378 aa AA seqDB search
MTSSGDSNDESYSKRKVAYVFSPEYIRTCDSLSKVPNRASMVHSLIEAYELLEHMNIVKP
ELATIEEMAKFHTDSYLEHLHKISQDGDNDDPQSADYGLGYDCPVVEGIFDYAAAVGGAT
LTAAQSLLDQKCDVAINWSGGWHHAKKDEASGFCYVNDAVLGILRLREKYERVLYVDVDL
HHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVCDTGLGKGRWYAVNVPLEDGIKDDR
YYQIFCSVMQEVYAHFNPEAVVMQLGADTMAGDPMCSFNMTPVGVGKCLQYVLGWRLPTL
LLGGGGYNLANTARCWTYLTAVVLGKSLSSEIPDHEFFTEYGPDYSLEISPSCRPDRNDL
KHLDQVVSTIKGNLKNVV
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgactagcagcggagatagtaatgacgaaagctacagtaaacgcaaagtggcctatgtt
tttagtccggagtatatccggacttgtgactctttatccaaagtaccaaaccgggcgagt
atggtacactcactaatagaagcctacgaactccttgaacacatgaacattgttaaacct
gagctggccacgatagaggaaatggcaaagttccacactgattcttacctggaacacctt
cacaagatcagccaggatggcgataacgatgacccccagtcagccgactatggcctcggt
tacgactgtccggtggtggagggaatatttgactatgcagcggcagtggggggcgctacg
ctgacagcagctcaaagtcttctggaccaaaagtgtgatgtagccatcaactggtctgga
gggtggcaccatgctaaaaaggacgaggcttcaggcttctgttacgtgaatgacgccgta
ctgggaattctcagactgagggaaaagtacgagagagtcctttatgtggacgttgacctg
catcatggggatggcgtagaagatgccttcagcttcacatccaaggtcatgaccgtctcc
ttgcacaagttctctccggggttcttcccaggtacaggtgacgtgtgtgacacagggctc
ggtaagggccgctggtacgccgtcaacgtgccgctggaggacggcatcaaggatgaccga
tactaccagattttttgcagtgtgatgcaggaagtgtacgcacacttcaacccagaggcc
gtcgtgatgcaactgggcgccgacaccatggcgggcgaccccatgtgctcctttaacatg
accccagtgggcgtgggcaagtgtctgcagtacgtcttggggtggcggctgcctacgctg
ctgctgggtggagggggttataacctagctaacacggcgcgctgctggacctacctgacg
gcggtggtgctgggaaagtccctgtcctctgagataccagaccacgagttttttacagag
tacggaccagactactcgctggagatcagccccagctgccggcccgaccgcaacgacctc
aaacacctggaccaggtggtcagcaccatcaaagggaatttaaagaatgtggtttag

DBGET integrated database retrieval system