KEGG   Takifugu rubripes (torafugu): 101077747Help
Entry
101077747         CDS       T02386                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K-like
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101077747
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
22
AA seq 792 aa AA seqDB search
MYFFFLASMPGERLAVRDASEVGRFPGVAPPTRVELTIHKEGEKKEEEGGCRRWLRKAFP
CCCQRQNSASLDVTDRVELVAPPTPPLLPEPPKSTPENGELKEMEEMKLSVCSVDLLSSK
TGQNRAEHHTDMYHGDELIVRRGQSFQIEVEFNRPFDTDTDKLHLDMRTGPLPTVSKGTH
ATVLLVDSPEDKRWAAKIVEQSGNKVKLSVNSPASAVCGLYGLTVTCGATTGEATTTHSC
SRNIVVLFNPWCEEDTVFLDDEEERKEYVLNDTGRIYYGTEKQIGARTWNFGQFHEGVLE
ACLFILEKSNIPPSGRGDPVNVVRVISAMINAQDDLGVLVGNWSGDYSDGVSPTAWSSSV
EILRKYHSSDGFPVSYGQCWVFSGVTTTVLRCLGIPARSVTNFQSAHDTDVSLTTDIYLD
ENMDPIDYLNSDSVWNFHVWNDCWMARPDLPPGHGGWQAVDSTPQETSQGTFRCGPASIS
AIRSGQVFLKHDTPFVFAEVNSDKIYWQRNLDGTFSQIYSEKKAVGHYISTKAVGSDERA
DITHLYKHQEGSEEERIAVETASRYGSKPNTYSSPVAEDVSVEVKIDDEGARMGADAQLS
ILVKNLSSHPRRTTLHSQVAVMYYTGVVKGTIKKEQISVELQPNEEKTIEWVLPYQQYQN
QLVDQAALMLTLSGRVNETQQVLANQTTFRLRTPDITIKPLGEAVVGKEMAAKITFTNPL
PRMLVGVVFRVEGLGLQKGHEVVVGDVGAHSTVTLTEHFIPTQPGPRKLVASLDCKQLTQ
VHGVADIVVLEK
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgtattttttttttcttgctagcatgccaggtgagcgattagcagtgagagatgcgtcc
gaagtggggcgtttccctggagtggccccgcccacaagggtggagctgaccattcacaaa
gaaggggagaagaaagaggaggaaggaggctgtcggcgctggctcaggaaggcgtttccg
tgctgctgtcagcggcagaacagcgcctccctggatgttacagacagggtggagttggtc
gcacctccgacccctccgctcctcccagagcccccaaaatcaacgcctgagaacggagag
ctaaaggaaatggaagagatgaagttatcggtgtgttctgtggacctgctgagctcgaag
acggggcagaacagagcggagcaccacaccgacatgtatcacggagacgagctgatcgtc
cgcagagggcagagcttccagatagaggtggagttcaaccgacccttcgacacagacact
gacaagctccacctggacatgagaacaggtcccctgcccacggtgtccaaaggcacccac
gccaccgtcctgctcgtggactcgccggaggacaaacgctgggcggccaagatcgtggag
cagagcggcaacaaggtgaagctgtcggtcaactcgccggccagcgccgtgtgtggcctc
tacgggctgacggtgacctgcggcgccacgacgggcgaagcgacaacgactcacagctgc
agcaggaacatcgtcgtgctcttcaacccttggtgtgaagaggacactgtgttcctggat
gatgaggaggagaggaaggagtatgtcctcaacgacactgggaggatttactacggcaca
gaaaaacaaataggcgctcgcacatggaactttgggcagtttcatgaaggggtcctggaa
gcatgtctgttcatcctggagaagagcaacatccccccgtctggcagaggggaccccgtc
aatgtggttcgagtcatatcggccatgatcaacgctcaggatgacttaggggttctggtg
ggcaactggtcgggggattactccgacggcgtgtctcctacagcgtggagcagcagcgtg
gagatcctgaggaaataccactcgtccgatgggtttcccgtgtcatacggacagtgttgg
gtcttctcaggagtcaccacgacagtgctccgatgtctcggcatccccgcccgcagcgtg
acgaactttcagtcggctcacgacaccgacgtctccctcaccaccgacatctatttagat
gagaacatggaccccatcgattacctcaacagtgactccgtttggaacttccacgtgtgg
aatgactgctggatggcgaggccagacctgcccccgggacatggaggctggcaggctgtg
gactcgactccccaggaaacaagccagggcaccttccgctgcggccccgcctccatcagc
gccatccgctcaggccaggtcttcctcaaacacgacacgccgtttgtctttgcagaggtc
aacagcgataagatctactggcagaggaacctggacggcacgttcagccagatctacagt
gagaagaaagccgttggccactacatcagcaccaaagccgtgggctctgacgagcgcgca
gacatcacgcacctgtacaaacaccaagaaggttctgaggaggaacgcatcgcggtcgag
accgccagtcgctacggcagcaagccaaacacctactcctcgcccgtggcggaggacgtc
agcgtggaggtgaagatcgatgatgagggggccagaatgggcgccgacgctcagctcagc
atcttggtgaagaacctcagctcgcaccctcgccggaccaccctgcacagccaggtggcg
gtcatgtactacaccggcgtggtgaagggcaccatcaagaaggagcagatttctgtggag
cttcagcccaatgaagaaaagaccatcgagtgggtgttaccctaccagcagtaccagaac
cagctggtggatcaggccgctctgatgttgaccctctctgggagagtaaacgagacccag
caggtgttagccaaccagaccaccttcaggctccgcacccctgacatcaccatcaagcct
ttaggagaagctgtcgtcggcaaagaaatggcggccaagatcaccttcactaacccgctg
ccacggatgctagtgggggtggtgttcagggtggagggcctggggctgcagaagggccat
gaggtggttgtcggtgatgttggcgcccactccaccgtgacactgacggagcacttcatc
cccacccagcctggacccaggaagctggtggcatctctggactgcaaacagctgacacaa
gtgcacggggtagctgatatcgtcgtcctggagaaatag

DBGET integrated database retrieval system