KEGG   Terriglobus saanensis: AciPR4_2183Help
Entry
AciPR4_2183       CDS       T01408                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
tsa  Terriglobus saanensis
Pathway
tsa00500  Starch and sucrose metabolism
tsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AciPR4_2183
Enzymes [BR:tsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AciPR4_2183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939
Motif
Other DBs
NCBI-ProteinID: ADV82985
JGI: AciPR4_2183
UniProt: E8V8K6
LinkDB All DBs
Position
2636392..2637723
Genome map
AA seq 443 aa AA seqDB search
MAVMMQAFYWDAPQKENKRGEWWNYLNSKIPELSAAGIDTMWLPPISKAASPDSPGYDPY
DYFDLGDFDQKGAIKTLYGNSAELKQLLASMREKHIGAIADMVINHNSGADEEEVNPLDG
QKRWTKFNPKSGRFPRDWNCFHPSRYEEAIIEGEEFAGFPHLCHRNPSVYKHMFDYARMI
IEELGFDGFRFDFVKGFGAWMIGILAKYKYERNGEEVRPFVVGEYWSGPEDIDNWLERVR
AVTEGQIAAFDFPLRYKLKDMCDTPNYDLRNLTDDGSVVSKRPFNAVTFVENHDMGGNEI
VNDKILAYSFILVNEGYPCIFWYDYYNLELARPLTPNGIDALIDAHHRYAGGEACILHAD
PDLYIMQRGGTEGQPGLIYVLNNLGDQWSGTSIKTKWHNQKFKPLAWSGHDEAHPDERTT
NENGEAEFPAPPRGYCIYVPIFE
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatgatgcaggcgttctactgggatgctccccaaaaggaaaacaagcgcggc
gagtggtggaattacctcaactccaaaatccccgaactgtcagccgcaggcatcgacacc
atgtggcttcccccgatctctaaagccgccagtcccgactcccctggatacgatccctac
gattacttcgacctcggcgacttcgaccagaagggcgcgatcaagaccctttatggcaac
tcagccgaactaaaacagctccttgccagcatgcgtgaaaagcatatcggcgcgattgcc
gacatggtcatcaaccacaactccggtgcggatgaagaagaggtcaatcctctcgatgga
cagaagcgttggaccaagttcaatcccaagagtggccgtttccctcgtgactggaactgt
ttccacccgtcccgctacgaagaagccatcatcgaaggcgaagagtttgccgggtttcct
cacctctgccaccgcaatccatcggtctacaaacacatgtttgattacgcccgcatgatc
atcgaagaacttggctttgacggcttccgcttcgacttcgtgaagggcttcggcgcatgg
atgatcggcattctcgccaagtataagtacgaacgtaacggcgaggaggttcgtcccttt
gttgtcggcgaatattggtccggccccgaagacatcgacaactggctcgaacgtgtacgc
gccgtcaccgagggccaaatcgccgcctttgactttccccttcgttacaagctgaaggac
atgtgtgatacccccaactacgatctccgcaacctcacagacgatggttccgtcgtctcc
aagcgcccgttcaatgccgtaacctttgtcgaaaaccacgacatgggtggcaatgagatc
gtgaatgacaagattctggcgtactctttcattctcgtgaacgagggctacccctgcatc
ttctggtacgactattacaatctcgaacttgcccgcccgcttacacccaacggcatcgac
gcgctcattgacgcccaccatcgctacgccggtggagaagcctgcatcctccacgcagat
ccagatctctacatcatgcagcgcggcggcacagaaggtcagcccggcctcatctacgtt
ctgaacaacctcggcgaccagtggtcaggtacgtcgatcaaaaccaagtggcataaccag
aagttcaagccgctcgcttggtctggccacgacgaagcgcatcctgacgaacgcaccacc
aacgaaaacggagaggctgagttccctgctccaccgcgtggctactgcatctacgtcccc
atcttcgaatag

DBGET integrated database retrieval system