KEGG   Terriglobus saanensis: AciPR4_3489Help
Entry
AciPR4_3489       CDS       T01408                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
tsa  Terriglobus saanensis
Pathway
tsa00500  Starch and sucrose metabolism
tsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AciPR4_3489
Enzymes [BR:tsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AciPR4_3489
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AciPR4_3489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C APH DUF3459 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ADV84243
JGI: AciPR4_3489
UniProt: E8UY09
LinkDB All DBs
Position
4215430..4218675
Genome map
AA seq 1081 aa AA seqDB search
MSEFATKKQGSATDPLWYKDAVIYELHVKAFADGNGDGIGDFQGLMEKLDYLQALGVTCI
WLLPFFPSPGRDDGYDISDYMSVNPNYGTVEDFQAFLEAAHARDMQVMIELVINHTSDQH
PWFQQARLAPPGSPERDMYVWSETDKLYSGVRIIFTDTEKSNWTWDETAQAYYWHRFFSH
QPDLNFDHPRVLEEVLNAMRFWMDMGVDGLRLDAIPYLVERDGTSCENVPETHVIIKKIR
AAIDAEYDNRLILAEANMWPADVRPYFGDGDECQMAFHFPLMPRIYMALRQEDRLPITEI
MAQTPAIPDSCQWGLFLRNHDELTLEMVTDDERDYMYLAYSGDPRMRINVGIRRRLAPLL
DNNRRRIELLNSLLFSFPGTPILYYGDEIGMGDNIYLGDRNGVRTPMQWNSDRNAGFSRA
VPAALYSPVIMDPIWGYQAINVEAQEQDTSSLLHWTRNMIALRKLFQVFGRGTQEFLKPE
NRKVLAYVREYNGERVVCVANLSRFAQPVTLDLSRWEGMVPVEMLGYVPFPPIDKSAYAI
TLGPYAFLWLELQDAPKAAETLPSAPPEVVIPASDIVGVLSGPGLELLQEAILPKYMARQ
RWFGAKTRTIQSTTVADWVLLPVEDAAILLVDVCYVEGPSERYTLPVAVRFDDTVVDDRF
VLTKVRGGSDAGSVAPSVAGASLHEGVLVDALSIQAVRDAVLALIEKNETLTTQHGTLQG
LRGTAVKAADGLVSRLTSAEQSNTSVLYGDQLILKMFRRIEEGVNPDVELGRFLTEETGF
AYTAAFAGEIAYTVPGVEDAPEKRYTLGLLQAQVKNVGDGWEWTQAELARIGTVSQPGIK
EFASYIAAARVLAERTAEMHRAFAGGASAEIAPEQPTSAKLAADAARLRAQVKRTLSTLK
HKFVDLPEDLEEIAASLLSKRSAMDEVVQRLEKLPATEAGLWTRIHGDYHLGQILRTEKD
FALLDFEGEPAKSLVERRKRQSPLRDVAGMLRSFSYAGAAYAHEHGETSGWVSLWEAEVS
KEFLSAYEAASGGRLSASRRVMLQAYLLEKAMYELQYELDSRPTWAHIPLRGILRLLGIA
G
NT seq 3246 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgagtttgcaacgaagaagcaggggagcgcgaccgatccgctctggtacaaagat
gccgttatctatgaactgcatgtgaaggcgttcgccgacggaaatggcgacggcatcggc
gatttccaggggttgatggagaagctggactacctgcaagcgttgggcgtcacgtgcatc
tggcttctgccgttctttccctcgccgggacgcgatgacggctacgacatctccgattac
atgagcgtgaacccgaattacgggacagtggaagacttccaggcgttcctggaagccgcc
catgcacgcgatatgcaggtgatgatcgaactcgtcatcaatcacacgagcgatcaacat
ccgtggtttcagcaggcgcgtctggctcctccaggatctcccgagcgcgacatgtacgtt
tggagcgagacggacaagctgtacagcggcgtccgcatcatctttaccgatacggaaaaa
tcgaactggacgtgggacgagacggcacaggcttactactggcaccgtttcttttcgcat
cagcccgatttgaacttcgatcatccgcgcgttttggaagaagtcctgaatgccatgcgc
ttctggatggatatgggcgtcgacggcctgcgtctggatgcaattccctatcttgtggaa
cgcgatggaacgagttgcgaaaacgttccggagacgcacgtcatcatcaagaagatccgc
gcggccatcgatgcggagtatgacaaccgcctgatcctggctgaggccaacatgtggccc
gccgatgtgcgcccctactttggcgatggcgacgagtgccagatggccttccattttccg
ttgatgccacgtatctacatggcgctgcgacaggaagaccgccttccgattaccgaaatc
atggcccagacaccggcgattccggattcgtgccaatggggacttttcctacgcaaccac
gatgaactgacgctggagatggtgacggacgacgagcgcgactatatgtacctcgcctac
tcgggcgatccgcgcatgcgcatcaacgtgggcattcgccgcaggctcgcaccgttgctg
gacaacaatcgccgccgcattgagttgctgaactcgcttctgttttccttcccgggaacg
ccgatcctttactacggcgatgagattgggatgggcgacaacatctatcttggcgaccgc
aacggcgtacgtacgccgatgcagtggaacagcgatcgcaatgcgggcttctcccgtgct
gtgcctgcggccctgtattcgccggtgatcatggacccgatctggggctaccaggcgatc
aacgtggaagcgcaggagcaggacacctcttcccttctgcactggacgcgcaacatgatt
gcgctacggaaactcttccaggtctttggcagagggacgcaggagttcctcaagccggag
aatcgcaaagtgctcgcctatgtgcgcgagtacaacggcgagcgcgtcgtctgcgtagcg
aacctctcgcgttttgcgcagcctgtgacattggatctctcgcgctgggagggcatggtg
ccggtagagatgctgggctatgtcccttttccgccgatcgacaagtcagcttacgccatc
acacttgggccctacgcgttcctatggctggagttgcaagacgcgccgaaggctgcggag
accttgccgagcgcaccgcctgaggtcgtcattcccgcgagcgatatcgtgggcgtgttg
agcggaccgggccttgaactcctgcaggaagccattctgccgaagtacatggcgcggcaa
cggtggttcggcgcgaagacgcgcacgatccagagcacgaccgtcgctgactgggttctt
ttgccagtagaagatgcggccattctgcttgtggacgtttgctatgtggaaggcccaagc
gaacggtacaccctgccggtagcggtgcgttttgacgacacagtcgtagacgatcgcttc
gtcctgacgaaggtgcgtggtggcagtgatgcgggctccgtggctccttctgtagcaggc
gcgagtctgcatgaaggtgtcctggtggacgcgctctcgattcaagccgtccgcgatgcc
gtgctcgctctgatcgaaaagaacgagacgctaacgacgcagcacggtactctgcagggc
cttcgtggcacagcggtgaaagcagcggacggcctggtctcgcgtttgacctctgccgag
cagagcaacacctcggtgctctatggcgatcagctcattctgaagatgttccgcagaatc
gaagagggcgtgaatccggatgtggagcttggacgcttcctgaccgaagagaccgggttt
gcctacaccgccgcgtttgcaggagagatcgcttacacggttccgggcgtagaagatgca
ccggagaaacgctacacgctgggacttctgcaggcccaggtgaagaacgtgggcgatggg
tgggagtggacgcaggcggaacttgcccgcatcggcacggtcagccagccgggcataaag
gagttcgcttcgtatatcgctgcggcacgcgttctggcagagcgtacggcggagatgcat
cgcgcctttgctgggggcgccagtgcggagatcgcgccggaacaacctacctcggccaag
ctggctgcggacgcggcgcgtctgcgggcgcaggtcaagcgtacgctttcgacgctgaag
cataagttcgtcgatcttccggaagacctggaagagatcgcggcgagtctgctttcgaag
cgatctgcaatggacgaagtcgtgcagcggctggagaagctgcctgcaaccgaggcagga
ctttggacgaggattcacggggactatcacctggggcagattctgcgcacagaaaaagat
ttcgcccttctggactttgaaggcgaaccggcgaagtcgctggtggagcgccgaaagcgg
cagtctcccctgcgcgatgtcgcgggcatgctgcggtcgttcagctacgctggtgcggcc
tatgcgcatgagcacggcgagacgtcaggatgggtttcactgtgggaagcagaagtgtcc
aaggagtttttgagtgcgtacgaagctgcctccggcgggcgattgagtgcgtcacggcgc
gtcatgctgcaggcgtaccttctggaaaaagcgatgtacgagttgcagtacgagttggat
agccgcccgacgtgggcgcacatcccgctcagaggtatcttgagactgttagggattgct
ggttag

DBGET integrated database retrieval system